Recombinant Human NR4A2
Cat.No. : | NR4A2-30493TH |
Product Overview : | Recombinant fragment corresponding to amino acids 71-170 of Human Nurr1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP |
Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR4 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
Gene Name | NR4A2 nuclear receptor subfamily 4, group A, member 2 [ Homo sapiens ] |
Official Symbol | NR4A2 |
Synonyms | NR4A2; nuclear receptor subfamily 4, group A, member 2; NURR1; nuclear receptor subfamily 4 group A member 2; HZF 3; NOT; RNR1; TINUR; |
Gene ID | 4929 |
mRNA Refseq | NM_006186 |
Protein Refseq | NP_006177 |
MIM | 601828 |
Uniprot ID | P43354 |
Chromosome Location | 2q22-q23 |
Pathway | Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem; |
Function | ligand-dependent nuclear receptor activity; metal ion binding; protein binding; protein heterodimerization activity; receptor activity; |
◆ Recombinant Proteins | ||
NR4A2-3097R | Recombinant Rhesus monkey NR4A2 Protein, His-tagged | +Inquiry |
NR4A2-2916R | Recombinant Rhesus Macaque NR4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR4A2-1542H | Recombinant Human NR4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR4A2-3543H | Recombinant Human NR4A2 Protein, His-tagged | +Inquiry |
Nr4a2-4491M | Recombinant Mouse Nr4a2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A2-3707HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
NR4A2-3708HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR4A2 Products
Required fields are marked with *
My Review for All NR4A2 Products
Required fields are marked with *
0
Inquiry Basket