Recombinant Human NR4A2

Cat.No. : NR4A2-30493TH
Product Overview : Recombinant fragment corresponding to amino acids 71-170 of Human Nurr1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP
Sequence Similarities : Belongs to the nuclear hormone receptor family. NR4 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name NR4A2 nuclear receptor subfamily 4, group A, member 2 [ Homo sapiens ]
Official Symbol NR4A2
Synonyms NR4A2; nuclear receptor subfamily 4, group A, member 2; NURR1; nuclear receptor subfamily 4 group A member 2; HZF 3; NOT; RNR1; TINUR;
Gene ID 4929
mRNA Refseq NM_006186
Protein Refseq NP_006177
MIM 601828
Uniprot ID P43354
Chromosome Location 2q22-q23
Pathway Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem;
Function ligand-dependent nuclear receptor activity; metal ion binding; protein binding; protein heterodimerization activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR4A2 Products

Required fields are marked with *

My Review for All NR4A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon