Recombinant Human NRAS protein, 10xHis-GST&Myc-tagged
| Cat.No. : | NRAS-4434H |
| Product Overview : | Recombinant Human NRAS protein(P01111)(1-186aa), fused to N-terminal His and GST tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 1-186aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 56.1 kDa |
| AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | NRAS neuroblastoma RAS viral (v-ras) oncogene homolog [ Homo sapiens ] |
| Official Symbol | NRAS |
| Synonyms | NRAS; neuroblastoma RAS viral (v-ras) oncogene homolog; GTPase NRas; N ras; N-ras protein part 4; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog; NS6; ALPS4; N-ras; NRAS1; |
| Gene ID | 4893 |
| mRNA Refseq | NM_002524 |
| Protein Refseq | NP_002515 |
| MIM | 164790 |
| UniProt ID | P01111 |
| ◆ Recombinant Proteins | ||
| NRAS-0940H | Recombinant Human NRAS Protein (M1-K169), Biotinylated tagged | +Inquiry |
| NRAS-6106H | Recombinant Human NRAS Protein, GST-tagged | +Inquiry |
| NRAS-0932H | Recombinant Human NRAS Protein (T2-K169, Q61K), Tag Free | +Inquiry |
| NRAS-0941H | Recombinant Human NRAS Protein (M1-K169, G13D), Biotinylated tagged | +Inquiry |
| NRAS-30411TH | Recombinant Human NRAS Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRAS-3702HCL | Recombinant Human NRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRAS Products
Required fields are marked with *
My Review for All NRAS Products
Required fields are marked with *



