Recombinant Human NRAS protein, 10xHis-GST&Myc-tagged
Cat.No. : | NRAS-4434H |
Product Overview : | Recombinant Human NRAS protein(P01111)(1-186aa), fused to N-terminal His and GST tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 1-186aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.1 kDa |
AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | NRAS neuroblastoma RAS viral (v-ras) oncogene homolog [ Homo sapiens ] |
Official Symbol | NRAS |
Synonyms | NRAS; neuroblastoma RAS viral (v-ras) oncogene homolog; GTPase NRas; N ras; N-ras protein part 4; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog; NS6; ALPS4; N-ras; NRAS1; |
Gene ID | 4893 |
mRNA Refseq | NM_002524 |
Protein Refseq | NP_002515 |
MIM | 164790 |
UniProt ID | P01111 |
◆ Recombinant Proteins | ||
NRAS-6750HF | Recombinant Full Length Human NRAS Protein, GST tagged | +Inquiry |
NRAS-0941H | Recombinant Human NRAS Protein (M1-K169, G13D), Biotinylated tagged | +Inquiry |
NRAS-1279H | Recombinant Human Neuroblastoma RAS Viral (v-ras) Oncogene Homolog | +Inquiry |
Nras-4494M | Recombinant Mouse Nras Protein, Myc/DDK-tagged | +Inquiry |
NRAS-756C | Recombinant Cynomolgus NRAS Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRAS-3702HCL | Recombinant Human NRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRAS Products
Required fields are marked with *
My Review for All NRAS Products
Required fields are marked with *
0
Inquiry Basket