Recombinant Human NRAS protein, 10xHis-GST&Myc-tagged

Cat.No. : NRAS-4434H
Product Overview : Recombinant Human NRAS protein(P01111)(1-186aa), fused to N-terminal His and GST tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His&Myc
Protein Length : 1-186aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 56.1 kDa
AA Sequence : MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name NRAS neuroblastoma RAS viral (v-ras) oncogene homolog [ Homo sapiens ]
Official Symbol NRAS
Synonyms NRAS; neuroblastoma RAS viral (v-ras) oncogene homolog; GTPase NRas; N ras; N-ras protein part 4; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog; NS6; ALPS4; N-ras; NRAS1;
Gene ID 4893
mRNA Refseq NM_002524
Protein Refseq NP_002515
MIM 164790
UniProt ID P01111

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRAS Products

Required fields are marked with *

My Review for All NRAS Products

Required fields are marked with *

0
cart-icon
0
compare icon