Recombinant Human NRAS Protein, GST-tagged
Cat.No. : | NRAS-6106H |
Product Overview : | Human NRAS full-length ORF ( NP_002515.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated to a GTP-bound form by a GTPase activating protein and inactivated to a GDP-bound form by a guanine nucleotide-exchange factor. Defects in this gene are a cause of juvenile myelomonocytic leukemia (JMML). [provided by RefSeq |
Molecular Mass : | 47.6 kDa |
AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NRAS neuroblastoma RAS viral (v-ras) oncogene homolog [ Homo sapiens ] |
Official Symbol | NRAS |
Synonyms | NRAS; neuroblastoma RAS viral (v-ras) oncogene homolog; GTPase NRas; N ras; N-ras protein part 4; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog; NS6; ALPS4; N-ras; NRAS1; |
Gene ID | 4893 |
mRNA Refseq | NM_002524 |
Protein Refseq | NP_002515 |
MIM | 164790 |
UniProt ID | P01111 |
◆ Recombinant Proteins | ||
NRAS-0930H | Recombinant Human NRAS Protein (T2-K169), GST tagged | +Inquiry |
NRAS-6750HF | Recombinant Full Length Human NRAS Protein, GST tagged | +Inquiry |
NRAS-0936H | Recombinant Human NRAS Protein (T2-K169, Q61H), Tag Free | +Inquiry |
NRAS-1544H | Recombinant Human NRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
NRAS-0935H | Recombinant Human NRAS Protein (T2-K169, Q61H), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRAS-3702HCL | Recombinant Human NRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NRAS Products
Required fields are marked with *
My Review for All NRAS Products
Required fields are marked with *
0
Inquiry Basket