Recombinant Human NRAS Protein, GST-tagged
| Cat.No. : | NRAS-6106H |
| Product Overview : | Human NRAS full-length ORF ( NP_002515.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated to a GTP-bound form by a GTPase activating protein and inactivated to a GDP-bound form by a guanine nucleotide-exchange factor. Defects in this gene are a cause of juvenile myelomonocytic leukemia (JMML). [provided by RefSeq |
| Molecular Mass : | 47.6 kDa |
| AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NRAS neuroblastoma RAS viral (v-ras) oncogene homolog [ Homo sapiens ] |
| Official Symbol | NRAS |
| Synonyms | NRAS; neuroblastoma RAS viral (v-ras) oncogene homolog; GTPase NRas; N ras; N-ras protein part 4; transforming protein N-Ras; v-ras neuroblastoma RAS viral oncogene homolog; NS6; ALPS4; N-ras; NRAS1; |
| Gene ID | 4893 |
| mRNA Refseq | NM_002524 |
| Protein Refseq | NP_002515 |
| MIM | 164790 |
| UniProt ID | P01111 |
| ◆ Recombinant Proteins | ||
| NRAS-0943H | Recombinant Human NRAS Protein (M1-K169, Q61R), Biotinylated tagged | +Inquiry |
| NRAS-1544H | Recombinant Human NRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
| NRAS-0937H | Recombinant Human NRAS Protein (T2-K169, Q61R), GST tagged | +Inquiry |
| NRAS-4076R | Recombinant Rat NRAS Protein | +Inquiry |
| NRAS-0942H | Recombinant Human NRAS Protein (M1-K169, Q61K), Biotinylated tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRAS-3702HCL | Recombinant Human NRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRAS Products
Required fields are marked with *
My Review for All NRAS Products
Required fields are marked with *
