Recombinant Human NRG1-β Protein

Cat.No. : NRG1-215H
Product Overview : Recombinant Human NRG1-β Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Neuregulin 1-beta (NRG1-β) is one of many alternatively-spliced isoforms of the NRG1 gene and contains a soluble EGF-like domain. The EGF-like domain of NRG1-β signals through the ErbB2, ErbB3, and ErbB4 receptor tyrosine kinases. NRG1-β is an important growth factor involved in neuroinflammation, nerve regeneration, and cardiovascular processes.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 7.6 kDa (66 aa)
AA Sequence : MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name NRG1 neuregulin 1 [ Homo sapiens (human) ]
Official Symbol NRG1
Synonyms NRG1; neuregulin 1; HGL; pro-neuregulin-1, membrane-bound isoform; GGF; HRG; NDF; MSTP131; pro-NRG1; glial growth factor; neu differentiation factor; neuregulin 1 type IV beta 3; neuregulin 1 type IV beta 1a; sensory and motor neuron derived factor; heregulin, alpha (45kD, ERBB2 p185-activator); ARIA; GGF2; HRG1; HRGA; SMDF; MST131;
Gene ID 3084
mRNA Refseq NM_001159995
Protein Refseq NP_001153467
MIM 142445
UniProt ID Q02297

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRG1 Products

Required fields are marked with *

My Review for All NRG1 Products

Required fields are marked with *

0
cart-icon
0
compare icon