Recombinant Human NRG1-β Protein
| Cat.No. : | NRG1-215H | 
| Product Overview : | Recombinant Human NRG1-β Protein without tag was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Description : | Neuregulin 1-beta (NRG1-β) is one of many alternatively-spliced isoforms of the NRG1 gene and contains a soluble EGF-like domain. The EGF-like domain of NRG1-β signals through the ErbB2, ErbB3, and ErbB4 receptor tyrosine kinases. NRG1-β is an important growth factor involved in neuroinflammation, nerve regeneration, and cardiovascular processes. | 
| Bio-activity : | No biological activity data is available at this time. | 
| Molecular Mass : | Monomer, 7.6 kDa (66 aa) | 
| AA Sequence : | MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE | 
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL | 
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE | 
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. | 
| Storage : | Storage Prior to Reconstitution: -20 centigrade | 
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) | 
| Reconstitution : | Sterile water at 0.1 mg/mL | 
| Shipping : | Room temperature | 
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. | 
| Gene Name | NRG1 neuregulin 1 [ Homo sapiens (human) ] | 
| Official Symbol | NRG1 | 
| Synonyms | NRG1; neuregulin 1; HGL; pro-neuregulin-1, membrane-bound isoform; GGF; HRG; NDF; MSTP131; pro-NRG1; glial growth factor; neu differentiation factor; neuregulin 1 type IV beta 3; neuregulin 1 type IV beta 1a; sensory and motor neuron derived factor; heregulin, alpha (45kD, ERBB2 p185-activator); ARIA; GGF2; HRG1; HRGA; SMDF; MST131; | 
| Gene ID | 3084 | 
| mRNA Refseq | NM_001159995 | 
| Protein Refseq | NP_001153467 | 
| MIM | 142445 | 
| UniProt ID | Q02297 | 
| ◆ Recombinant Proteins | ||
| NRG1-4239H | Recombinant Human NRG1 Protein (Met1-Lys246), N-His tagged | +Inquiry | 
| NRG1-29H | Recombinant Human/Bovine/Porcine NRG1 Protein | +Inquiry | 
| NRG1-710H | Recombinant Human NRG1 Protein, His-tagged | +Inquiry | 
| NRG1-5693C | Recombinant Chicken NRG1 | +Inquiry | 
| NRG1-239H | Recombinant Human NRG1 Protein, Fc-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NRG1-1592HCL | Recombinant Human NRG1 cell lysate | +Inquiry | 
| NRG1-836CCL | Recombinant Canine NRG1 cell lysate | +Inquiry | 
| NRG1-001CCL | Recombinant Canine NRG1 cell lysate | +Inquiry | 
| NRG1-1675HCL | Recombinant Human NRG1 cell lysate | +Inquiry | 
| NRG1-1599HCL | Recombinant Human NRG1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG1 Products
Required fields are marked with *
My Review for All NRG1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            