Active Recombinant Human NRG4 Protein, Tag Free

Cat.No. : NRG4-1021H
Product Overview : Optimized DNA sequence encoding Human Neuregulin-4 EGF domainwas expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation.
Bio-activity : The ED(50) was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be < 3 ng/mL.
Molecular Mass : 7 kDa
AASequence : MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
Endotoxin : Less than 0.1 ng/μg (1 EU/μg).
Purity : >96%, as determined by SDS-PAGE and HPLC
Notes : This cytokine product is for research purposes only. It may not be used for therapeutics or diagnostic purposes.
Storage : The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this cytokine can be stored in working aliquots at2 to 8 centigrade for one month, or at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles.
Storage Buffer : Recombinant Neuregulin-4was lyophilized from a 0.2 μm filteredmM PB, pH7.0.
Reconstitution : A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 0.1 mg/mL. This solution can then be diluted into other buffers.
Gene Name NRG4 neuregulin 4 [ Homo sapiens (human) ]
Official Symbol NRG4
Synonyms NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944
Gene ID 145957
mRNA Refseq NM_138573
Protein Refseq NP_612640
MIM 610894
UniProt ID Q8WWG1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRG4 Products

Required fields are marked with *

My Review for All NRG4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon