Active Recombinant Human NRG4 Protein, Tag Free

• Cat.No.: NRG4-1021H
• Product Overview: Optimized DNA sequence encoding Human Neuregulin-4 EGF domainwas expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation.
• Bio-activity: The ED(50) was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be < 3 ng/mL.
• Molecular Mass: 7 kDa
• AASequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
• Endotoxin: Less than 0.1 ng/μg (1 EU/μg).
• Purity: >96%, as determined by SDS-PAGE and HPLC
• Notes: This cytokine product is for research purposes only. It may not be used for therapeutics or diagnostic purposes.
• Storage: The lyophilized protein is stable for at least years from date of receipt at -20 centigrade. Upon reconstitution, this cytokine can be stored in working aliquots at2 to 8 centigrade for one month, or at -20 centigrade for six months, with a carrier protein without detectable loss of activity. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Recombinant Neuregulin-4was lyophilized from a 0.2 μm filteredmM PB, pH7.0.
• Reconstitution: A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 0.1 mg/mL. This solution can then be diluted into other buffers.

Gene Information

• Gene Name: NRG4 neuregulin 4 [ Homo sapiens (human) ]
• Official Symbol: NRG4
• Synonyms: NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944
• Gene ID: 145957
• mRNA Refseq: NM_138573
• Protein Refseq: NP_612640
• MIM: 610894
• UniProt ID: Q8WWG1