Recombinant Human NRG4 protein, SUMO&His-tagged
Cat.No. : | NRG4-4042H |
Product Overview : | Recombinant Human NRG4 protein(Q8WWG1)(Pro11-Asn60), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | Pro11-Asn60 |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C/-80°C. |
AA Sequence : | PSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN |
Official Symbol | NRG4 |
Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944; |
Gene ID | 145957 |
mRNA Refseq | NM_138573 |
Protein Refseq | NP_612640 |
MIM | 610894 |
UniProt ID | Q8WWG1 |
◆ Recombinant Proteins | ||
NRG4-07H | Active Recombinant Human NRG4 Protein | +Inquiry |
NRG4-365H | Recombinant Human NRG4 Protein, His/GST-tagged | +Inquiry |
NRG4-452H | Recombinant Human NRG4 protein(Pro2-Phe62) | +Inquiry |
NRG4-09H | Recombinant Human NRG4 Protein | +Inquiry |
NRG4-4042H | Recombinant Human NRG4 protein, SUMO&His-tagged | +Inquiry |
◆ Native Proteins | ||
NRG4-1021H | Active Recombinant Human NRG4 Protein, Tag Free | +Inquiry |
NRG4-15H | Active Recombinant Human NRG4 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *