Recombinant Human NSUN7 protein, His-tagged
Cat.No. : | NSUN7-8867H |
Product Overview : | Recombinant Human NSUN7 protein(332-475 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 332-475 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | DPDLKTLFTKIGCKNIEILHEKFINIESKDHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYEQLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYSGTLLRQCL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NSUN7 NOP2/Sun domain family, member 7 [ Homo sapiens ] |
Official Symbol | NSUN7 |
Synonyms | NSUN7; NOP2/Sun domain family, member 7; NOL1/NOP2/Sun domain family, member 7; putative methyltransferase NSUN7; FLJ14001; NOL1/NOP2/Sun domain family member 7; |
Gene ID | 79730 |
mRNA Refseq | NM_024677 |
Protein Refseq | NP_078953 |
UniProt ID | Q8NE18 |
◆ Recombinant Proteins | ||
NSUN7-8867H | Recombinant Human NSUN7 protein, His-tagged | +Inquiry |
NSUN7-8866H | Recombinant Human NSUN7 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSUN7 Products
Required fields are marked with *
My Review for All NSUN7 Products
Required fields are marked with *
0
Inquiry Basket