Recombinant Human NTF4 protein
Cat.No. : | NTF4-16H |
Product Overview : | Recombinant Human NTF4 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 131 |
Description : | NT-4 also named as NT-5 is a neuronal and epithelial grow factor belongs to the NGF-beta family. The NT-4 precursor is consisted of a 24 a.a. signal peptide, a 56 a.a. propertied and 130 a.a. NT-4. The mature protein has six Cys amino acid residues and has the relative structure with NT-3, BDNF (sharing about 48 % - 52 % sequence identity). Additionally, it shares 91 % and 95 % a.a. sequence identity with mouse and rat NT-4. NT-4 is mainly expressed in prostate and has low level thymus, placenta, and skeletal muscle. It can binding with the LNGFR and trkB receptors and plays a crucial role in the regulation of survival and the maintenance of peripheral sensory sympathetic neurons. Defect of NT-4 may cause primary open angle glaucoma type 1O. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 5.5. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg. |
Molecular Mass : | Approximately 28.1 kDa, a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (262 total amino acid residues). |
AA Sequence : | MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Endotoxin : | Less than 1 EU/μg of rHuNT-4 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | NTF4 |
Official Symbol | NTF4 |
Synonyms | NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5; |
Gene ID | 4909 |
mRNA Refseq | NM_006179 |
Protein Refseq | NP_006170 |
MIM | 162662 |
UniProt ID | P34130 |
◆ Recombinant Proteins | ||
Ntf4-164R | Recombinant Rat Ntf4 Protein, His-tagged | +Inquiry |
NTF4-2933R | Recombinant Rhesus Macaque NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NTF4-067N | Active Recombinant Human NTF4 Protein (260 aa) | +Inquiry |
NTF4-4099R | Recombinant Rat NTF4 Protein | +Inquiry |
NTF4-162H | Recombinant Human NTF4 protein, His/S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTF4-3669HCL | Recombinant Human NTF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTF4 Products
Required fields are marked with *
My Review for All NTF4 Products
Required fields are marked with *
0
Inquiry Basket