Recombinant Human NUCB2 protein, GST-tagged
Cat.No. : | NUCB2-3745H |
Product Overview : | Recombinant Human NUCB2 protein(25-106 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-106 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NUCB2 nucleobindin 2 [ Homo sapiens ] |
Official Symbol | NUCB2 |
Synonyms | NUCB2; nucleobindin 2; nucleobindin-2; NEFA; nucleobinding 2; DNA-binding protein NEFA; gastric cancer antigen Zg4; |
Gene ID | 4925 |
mRNA Refseq | NM_005013 |
Protein Refseq | NP_005004 |
MIM | 608020 |
UniProt ID | P80303 |
◆ Recombinant Proteins | ||
NUCB2-654H | Recombinant Human NUCB2 protein | +Inquiry |
Nucb2-4528M | Recombinant Mouse Nucb2 Protein, Myc/DDK-tagged | +Inquiry |
NUCB2-014H | Recombinant Hamster Nucleobindin 2 Protein, His tagged | +Inquiry |
NUCB2-3771R | Recombinant Rat NUCB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUCB2-2169H | Recombinant Human Nucleobindin 2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUCB2 Products
Required fields are marked with *
My Review for All NUCB2 Products
Required fields are marked with *
0
Inquiry Basket