Recombinant Human NUCB2 protein, GST-tagged
| Cat.No. : | NUCB2-3745H |
| Product Overview : | Recombinant Human NUCB2 protein(25-106 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 10, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 25-106 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NUCB2 nucleobindin 2 [ Homo sapiens ] |
| Official Symbol | NUCB2 |
| Synonyms | NUCB2; nucleobindin 2; nucleobindin-2; NEFA; nucleobinding 2; DNA-binding protein NEFA; gastric cancer antigen Zg4; |
| Gene ID | 4925 |
| mRNA Refseq | NM_005013 |
| Protein Refseq | NP_005004 |
| MIM | 608020 |
| UniProt ID | P80303 |
| ◆ Recombinant Proteins | ||
| NUCB2-3771R | Recombinant Rat NUCB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUCB2-3745H | Recombinant Human NUCB2 protein, GST-tagged | +Inquiry |
| Nucb2-1959R | Recombinant Rat Nucleobindin 2 | +Inquiry |
| NUCB2-3689H | Recombinant Human NUCB2, His-tagged | +Inquiry |
| NUCB2-2810H | Recombinant Human NUCB2 protein(31-410 aa), C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUCB2 Products
Required fields are marked with *
My Review for All NUCB2 Products
Required fields are marked with *
