Recombinant Human NUDT1 protein, His-tagged
| Cat.No. : | NUDT1-6444H |
| Product Overview : | Recombinant Human NUDT1 protein(1-179 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-179 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | NUDT1 |
| Synonyms | NUDT1; nudix (nucleoside diphosphate linked moiety X)-type motif 1; MTH1; 7,8-dihydro-8-oxoguanine triphosphatase; 7; 8 dihydro 8 oxoguanine triphosphatase; 8 oxo 7; 8 dihydrodeoxyguanosine triphosphatase; 8 dihydroguanosine triphosphatase; 8 oxo dGTPase; mutT human homolog 1; nucleoside diphosphate linked moiety X type motif 1; nudix motif 1; 8-oxo-dGTPase; 2-hydroxy-dATP diphosphatase; 8-oxo-7,8-dihydroguanosine triphosphatase; 8-oxo-7,8-dihydrodeoxyguanosine triphosphatase; nucleoside diphosphate-linked moiety X motif 1; nucleoside diphosphate-linked moiety X-type motif 1; |
| Gene ID | 4521 |
| mRNA Refseq | NM_002452 |
| Protein Refseq | NP_002443 |
| MIM | 600312 |
| UniProt ID | P36639 |
| ◆ Recombinant Proteins | ||
| NUDT1-6444H | Recombinant Human NUDT1 protein, His-tagged | +Inquiry |
| NUDT1-2809H | Recombinant Human NUDT1 Protein (19-197 aa), His-tagged | +Inquiry |
| NUDT17536H | Recombinant Human NUDT1 (42-197) Protein | +Inquiry |
| NUDT1-1311C | Recombinant Chicken NUDT1 | +Inquiry |
| NUDT1-30252TH | Recombinant Human NUDT1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUDT1-3655HCL | Recombinant Human NUDT1 293 Cell Lysate | +Inquiry |
| NUDT1-3656HCL | Recombinant Human NUDT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT1 Products
Required fields are marked with *
My Review for All NUDT1 Products
Required fields are marked with *



