Recombinant Human NUDT15 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NUDT15-4386H |
Product Overview : | NUDT15 MS Standard C13 and N15-labeled recombinant protein (NP_060753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an enzyme that belongs to the Nudix hydrolase superfamily. Members of this superfamily catalyze the hydrolysis of nucleoside diphosphates, including substrates like 8-oxo-dGTP, which are a result of oxidative damage, and can induce base mispairing during DNA replication, causing transversions. The encoded enzyme is a negative regulator of thiopurine activation and toxicity. Mutations in this gene result in poor metabolism of thiopurines, and are associated with thiopurine-induced early leukopenia. Multiple pseudogenes of this gene have been identified. |
Molecular Mass : | 18.4 kDa |
AA Sequence : | MTASAQPRGRRPGVGVGVVVTSCKHPRCVLLGKRKGSVGAGSFQLPGGHLEFGETWEECAQRETWEEAALHLKNVHFASVVNSFIEKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NUDT15 nudix hydrolase 15 [ Homo sapiens (human) ] |
Official Symbol | NUDT15 |
Synonyms | NUDT15; nudix hydrolase 15; MTH2; NUDT15D; nucleotide triphosphate diphosphatase NUDT15; 8-oxo-dGTPase NUDT15; mutT homolog 2; nucleoside diphosphate-linked to another moiety X hydrolase 15; nudix (nucleoside diphosphate linked moiety X)-type motif 15; probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15; probable 8-oxo-dGTP diphosphatase NUDT15; EC 3.6.1.9 |
Gene ID | 55270 |
mRNA Refseq | NM_018283 |
Protein Refseq | NP_060753 |
MIM | 615792 |
UniProt ID | Q9NV35 |
◆ Recombinant Proteins | ||
NUDT15-892HFL | Recombinant Full Length Human NUDT15 Protein, C-Flag-tagged | +Inquiry |
NUDT15-4386H | Recombinant Human NUDT15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDT15-337Z | Recombinant Zebrafish NUDT15 | +Inquiry |
NUDT15-11H | Recombinant Human NUDT15 Protein, His-tagged | +Inquiry |
NUDT15-6250M | Recombinant Mouse NUDT15 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT15-3651HCL | Recombinant Human NUDT15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT15 Products
Required fields are marked with *
My Review for All NUDT15 Products
Required fields are marked with *