Recombinant Human NUDT15 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NUDT15-4386H
• Product Overview: NUDT15 MS Standard C13 and N15-labeled recombinant protein (NP_060753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes an enzyme that belongs to the Nudix hydrolase superfamily. Members of this superfamily catalyze the hydrolysis of nucleoside diphosphates, including substrates like 8-oxo-dGTP, which are a result of oxidative damage, and can induce base mispairing during DNA replication, causing transversions. The encoded enzyme is a negative regulator of thiopurine activation and toxicity. Mutations in this gene result in poor metabolism of thiopurines, and are associated with thiopurine-induced early leukopenia. Multiple pseudogenes of this gene have been identified.
• Molecular Mass: 18.4 kDa
• AA Sequence: MTASAQPRGRRPGVGVGVVVTSCKHPRCVLLGKRKGSVGAGSFQLPGGHLEFGETWEECAQRETWEEAALHLKNVHFASVVNSFIEKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NUDT15 nudix hydrolase 15 [ Homo sapiens (human) ]
• Official Symbol: NUDT15
• Synonyms: NUDT15; nudix hydrolase 15; MTH2; NUDT15D; nucleotide triphosphate diphosphatase NUDT15; 8-oxo-dGTPase NUDT15; mutT homolog 2; nucleoside diphosphate-linked to another moiety X hydrolase 15; nudix (nucleoside diphosphate linked moiety X)-type motif 15; probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15; probable 8-oxo-dGTP diphosphatase NUDT15; EC 3.6.1.9
• Gene ID: 55270
• mRNA Refseq: NM_018283
• Protein Refseq: NP_060753
• MIM: 615792
• UniProt ID: Q9NV35