Recombinant Human NUDT16L1, His-tagged
Cat.No. : | NUDT16L1-31391TH |
Product Overview : | Recombinant full length Human SDOS with an N terminal His tag; 231aa, 25.5kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 211 amino acids |
Description : | NUDT16L1, also known Syndesmos, is a cytoplasmic protein that interacts specifically with the cytoplasmic domain of syndecan-4, and it co-localizes with syndecan-4 in focal contacts. |
Conjugation : | HIS |
Molecular Weight : | 25.500kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS |
Gene Name | NUDT16L1 nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 [ Homo sapiens ] |
Official Symbol | NUDT16L1 |
Synonyms | NUDT16L1; nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1; protein syndesmos; SDOS; |
Gene ID | 84309 |
mRNA Refseq | NM_001193452 |
Protein Refseq | NP_001180381 |
Uniprot ID | Q9BRJ7 |
Chromosome Location | 16p13.3 |
Pathway | Syndecan-4-mediated signaling events, organism-specific biosystem; |
Function | hydrolase activity; |
◆ Recombinant Proteins | ||
NUDT16L1-4932H | Recombinant Human NUDT16L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NUDT16L1-31391TH | Recombinant Human NUDT16L1, His-tagged | +Inquiry |
NUDT16L1-10967M | Recombinant Mouse NUDT16L1 Protein | +Inquiry |
Nudt16l1-4537M | Recombinant Mouse Nudt16l1 Protein, Myc/DDK-tagged | +Inquiry |
NUDT16L1-6251M | Recombinant Mouse NUDT16L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT16L1-3650HCL | Recombinant Human NUDT16L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT16L1 Products
Required fields are marked with *
My Review for All NUDT16L1 Products
Required fields are marked with *