Recombinant Human NUDT2
| Cat.No. : | NUDT2-29730TH | 
| Product Overview : | Recombinant Full Length Human NUDT2 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-147; 147 amino acids, 16.8kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Tag : | Non | 
| Protein Length : | 1-147 a.a. | 
| Description : | This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. | 
| Form : | Liquid | 
| Purity : | Immunogen affinity purified | 
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. | 
| Sequences of amino acids : | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTP PKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLE EACQLAQFKEMKAALQEGHQFLCSIEA | 
| Sequence Similarities : | Belongs to the Nudix hydrolase family.Contains 1 nudix hydrolase domain. | 
| Full Length : | Full L. | 
| Gene Name | NUDT2 nudix (nucleoside diphosphate linked moiety X)-type motif 2 [ Homo sapiens ] | 
| Official Symbol | NUDT2 | 
| Synonyms | NUDT2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; APAH1; bis(5-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4A hydrolase 1; Ap4Aase; bis(5 nucleosyl) tetraphosphatase (asymmetrical); diadenosine 5; 5 P1; P4 tetraphosphate pyrophosphohyd | 
| Gene ID | 318 | 
| mRNA Refseq | NM_001161 | 
| Protein Refseq | NP_001152 | 
| MIM | 602852 | 
| Uniprot ID | P50583 | 
| Chromosome Location | 9p13 | 
| Pathway | Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem; | 
| Function | GTP binding; bis(5-nucleosyl)-tetraphosphatase (asymmetrical) activity; bis(5-nucleosyl)-tetraphosphatase (symmetrical) activity; hydrolase activity; nucleotide binding; | 
| ◆ Recombinant Proteins | ||
| NUDT2-472Z | Recombinant Zebrafish NUDT2 | +Inquiry | 
| NUDT2-957H | Recombinant Human NUDT2, His-tagged | +Inquiry | 
| NUDT2-3664H | Recombinant Human NUDT2 protein, GST-tagged | +Inquiry | 
| NUDT2-29730TH | Recombinant Human NUDT2 | +Inquiry | 
| NUDT2-4116R | Recombinant Rat NUDT2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NUDT2-3648HCL | Recombinant Human NUDT2 293 Cell Lysate | +Inquiry | 
| NUDT2-3647HCL | Recombinant Human NUDT2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All NUDT2 Products
Required fields are marked with *
My Review for All NUDT2 Products
Required fields are marked with *
  
        
    
      
            