Recombinant Human NUDT2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NUDT2-6279H | 
| Product Overview : | NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671702) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. | 
| Molecular Mass : | 17.3 kDa | 
| AA Sequence : | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEATRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | NUDT2 nudix hydrolase 2 [ Homo sapiens (human) ] | 
| Official Symbol | NUDT2 | 
| Synonyms | NUDT2; nudix (nucleoside diphosphate linked moiety X)-type motif 2; APAH1; bis(5-nucleosyl)-tetraphosphatase [asymmetrical]; Ap4A hydrolase 1; Ap4Aase; bis(5 nucleosyl) tetraphosphatase (asymmetrical); diadenosine 5; 5 P1; P4 tetraphosphate pyrophosphohydrolase; diadenosine tetraphosphatase; nudix motif 2; nucleoside diphosphate-linked moiety X motif 2; bis(5-nucleosyl)-tetraphosphatase (asymmetrical); diadenosine 5,5-P1,P4-tetraphosphate pyrophosphohydrolase; diadenosine 5,5-P1,P4-tetraphosphate asymmetrical hydrolase; MGC10404; | 
| Gene ID | 318 | 
| mRNA Refseq | NM_147173 | 
| Protein Refseq | NP_671702 | 
| MIM | 602852 | 
| UniProt ID | P50583 | 
| ◆ Recombinant Proteins | ||
| NUDT2-3664H | Recombinant Human NUDT2 protein, GST-tagged | +Inquiry | 
| NUDT2-2945R | Recombinant Rhesus Macaque NUDT2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Nudt2-4539M | Recombinant Mouse Nudt2 Protein, Myc/DDK-tagged | +Inquiry | 
| NUDT2-6255M | Recombinant Mouse NUDT2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| NUDT2-3127R | Recombinant Rhesus monkey NUDT2 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NUDT2-3648HCL | Recombinant Human NUDT2 293 Cell Lysate | +Inquiry | 
| NUDT2-3647HCL | Recombinant Human NUDT2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All NUDT2 Products
Required fields are marked with *
My Review for All NUDT2 Products
Required fields are marked with *
  
        
    
      
            