Recombinant Human NUDT5 protein, His-tagged
| Cat.No. : | NUDT5-3874H |
| Product Overview : | Recombinant Human NUDT5 protein(1-219 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-219 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NUDT5 nudix (nucleoside diphosphate linked moiety X)-type motif 5 [ Homo sapiens ] |
| Official Symbol | NUDT5 |
| Synonyms | NUDT5; nudix (nucleoside diphosphate linked moiety X)-type motif 5; ADP-sugar pyrophosphatase; hYSAH1; YSA1H; nudix motif 5; nucleoside diphosphate-linked moiety X motif 5; nucleoside diphosphate linked moiety X-type motif 5; YSA1; |
| Gene ID | 11164 |
| mRNA Refseq | NM_014142 |
| Protein Refseq | NP_054861 |
| MIM | 609230 |
| UniProt ID | Q9UKK9 |
| ◆ Recombinant Proteins | ||
| NUDT5-770H | Recombinant Human NUDT5, His-tagged | +Inquiry |
| NUDT5-213H | Recombinant Human NUDT5, His tagged | +Inquiry |
| NUDT5-4120R | Recombinant Rat NUDT5 Protein | +Inquiry |
| Nudt5-4543M | Recombinant Mouse Nudt5 Protein, Myc/DDK-tagged | +Inquiry |
| NUDT5-3874H | Recombinant Human NUDT5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUDT5-3643HCL | Recombinant Human NUDT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT5 Products
Required fields are marked with *
My Review for All NUDT5 Products
Required fields are marked with *
