Recombinant Human NUDT5 protein, His-tagged
Cat.No. : | NUDT5-3874H |
Product Overview : | Recombinant Human NUDT5 protein(1-219 aa), fused to His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-219 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NUDT5 nudix (nucleoside diphosphate linked moiety X)-type motif 5 [ Homo sapiens ] |
Official Symbol | NUDT5 |
Synonyms | NUDT5; nudix (nucleoside diphosphate linked moiety X)-type motif 5; ADP-sugar pyrophosphatase; hYSAH1; YSA1H; nudix motif 5; nucleoside diphosphate-linked moiety X motif 5; nucleoside diphosphate linked moiety X-type motif 5; YSA1; |
Gene ID | 11164 |
mRNA Refseq | NM_014142 |
Protein Refseq | NP_054861 |
MIM | 609230 |
UniProt ID | Q9UKK9 |
◆ Recombinant Proteins | ||
NUDT5-10976M | Recombinant Mouse NUDT5 Protein | +Inquiry |
NUDT5-154H | Recombinant Human NUDT5 protein, His-tagged | +Inquiry |
NUDT5-6259M | Recombinant Mouse NUDT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT5-3781R | Recombinant Rat NUDT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nudt5-4543M | Recombinant Mouse Nudt5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT5-3643HCL | Recombinant Human NUDT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT5 Products
Required fields are marked with *
My Review for All NUDT5 Products
Required fields are marked with *