Recombinant Human NUP153 protein(341-410 aa), C-His-tagged

• Cat.No.: NUP153-2777H
• Product Overview: Recombinant Human NUP153 protein(P49790)(341-410 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 341-410 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DRSGIDITDFQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEK

Gene Information

• Gene Name: NUP153 nucleoporin 153kDa [ Homo sapiens ]
• Official Symbol: NUP153
• Synonyms: NUP153; nucleoporin 153kDa; nucleoporin 153kD; nuclear pore complex protein Nup153; HNUP153; nucleoporin Nup153; 153 kDa nucleoporin; nuclear pore complex protein hnup153; N153
• Gene ID: 9972
• mRNA Refseq: NM_005124
• Protein Refseq: NP_005115
• MIM: 603948
• UniProt ID: P49790