Recombinant Human NUP153 protein(341-410 aa), C-His-tagged

Cat.No. : NUP153-2777H
Product Overview : Recombinant Human NUP153 protein(P49790)(341-410 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 341-410 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DRSGIDITDFQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEK
Gene Name NUP153 nucleoporin 153kDa [ Homo sapiens ]
Official Symbol NUP153
Synonyms NUP153; nucleoporin 153kDa; nucleoporin 153kD; nuclear pore complex protein Nup153; HNUP153; nucleoporin Nup153; 153 kDa nucleoporin; nuclear pore complex protein hnup153; N153;
Gene ID 9972
mRNA Refseq NM_005124
Protein Refseq NP_005115
MIM 603948
UniProt ID P49790

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUP153 Products

Required fields are marked with *

My Review for All NUP153 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon