Recombinant Human NUP153 protein(341-410 aa), C-His-tagged
| Cat.No. : | NUP153-2777H |
| Product Overview : | Recombinant Human NUP153 protein(P49790)(341-410 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 341-410 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DRSGIDITDFQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEK |
| Gene Name | NUP153 nucleoporin 153kDa [ Homo sapiens ] |
| Official Symbol | NUP153 |
| Synonyms | NUP153; nucleoporin 153kDa; nucleoporin 153kD; nuclear pore complex protein Nup153; HNUP153; nucleoporin Nup153; 153 kDa nucleoporin; nuclear pore complex protein hnup153; N153; |
| Gene ID | 9972 |
| mRNA Refseq | NM_005124 |
| Protein Refseq | NP_005115 |
| MIM | 603948 |
| UniProt ID | P49790 |
| ◆ Recombinant Proteins | ||
| NUP153-2777H | Recombinant Human NUP153 protein(341-410 aa), C-His-tagged | +Inquiry |
| NUP153-5383H | Recombinant Human NUP153 Protein (Ser1238-Lys1468), N-GST tagged | +Inquiry |
| NUP153-1414H | Recombinant Human NUP153, GST-tagged | +Inquiry |
| NUP153-2954R | Recombinant Rhesus Macaque NUP153 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NUP153-3136R | Recombinant Rhesus monkey NUP153 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUP153 Products
Required fields are marked with *
My Review for All NUP153 Products
Required fields are marked with *
