| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
657-880 aa |
| Description : |
Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding elent in the nuclear phase of the NPC essential for normal nucleoCytoplasmic domain transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport elent (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear mbrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore mbrane. Possible DNA-binding subunit of the nuclear pore complex (NPC). |
| Form : |
Tris-based buffer, 50% glycerol |
| Molecular Mass : |
27.3 kDa |
| AA Sequence : |
KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG |
| Purity : |
> 90% as determined by SDS-PAGE. |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : |
A hardcopy of COA with concentration instruction is sent along with the products. |
