Recombinant Human NUP153 Protein (657-880 aa), His-tagged

Cat.No. : NUP153-695H
Product Overview : Recombinant Human NUP153 Protein (657-880 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 657-880 aa
Description : Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding elent in the nuclear phase of the NPC essential for normal nucleoCytoplasmic domain transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport elent (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear mbrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore mbrane. Possible DNA-binding subunit of the nuclear pore complex (NPC).
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 27.3 kDa
AA Sequence : KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name NUP153 nucleoporin 153kDa [ Homo sapiens ]
Official Symbol NUP153
Synonyms NUP153; nucleoporin 153kDa; HNUP153; N153;
Gene ID 9972
mRNA Refseq NM_005124
Protein Refseq NP_005115
MIM 603948
UniProt ID P49790

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUP153 Products

Required fields are marked with *

My Review for All NUP153 Products

Required fields are marked with *

0
cart-icon