Recombinant Human NXT1 protein, T7-tagged

Cat.No. : NXT1-210H
Product Overview : Recombinant human NXT1 (140 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 140 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRF QDWAS
Purity : >90% by SDS-PAGE.
Applications : 1. May be used for in vitro NXT1 mediated target specific mRNA nuclear export pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NXT1 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name NXT1 NTF2-like export factor 1 [ Homo sapiens ]
Official Symbol NXT1
Synonyms NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15; protein p15
Gene ID 29107
mRNA Refseq NM_013248
Protein Refseq NP_037380
MIM 605811
UniProt ID Q9UKK6
Chromosome Location 20p12-p11.2
Pathway Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function Ran GTPase binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NXT1 Products

Required fields are marked with *

My Review for All NXT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon