Recombinant Human NXT1 protein, T7-tagged
| Cat.No. : | NXT1-210H |
| Product Overview : | Recombinant human NXT1 (140 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 140 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRF QDWAS |
| Purity : | >90% by SDS-PAGE. |
| Applications : | 1. May be used for in vitro NXT1 mediated target specific mRNA nuclear export pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NXT1 protein-protein interaction.4. May be used as antigen for specific antibody development. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | NXT1 NTF2-like export factor 1 [ Homo sapiens ] |
| Official Symbol | NXT1 |
| Synonyms | NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15; protein p15 |
| Gene ID | 29107 |
| mRNA Refseq | NM_013248 |
| Protein Refseq | NP_037380 |
| MIM | 605811 |
| UniProt ID | Q9UKK6 |
| Chromosome Location | 20p12-p11.2 |
| Pathway | Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; |
| Function | Ran GTPase binding; protein binding; |
| ◆ Recombinant Proteins | ||
| NXT1-3523H | Recombinant Human NTF2-Like Export Factor 1, His-tagged | +Inquiry |
| NXT1-2963R | Recombinant Rhesus Macaque NXT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NXT1-5172H | Recombinant Human NXT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NXT1-28306TH | Recombinant Human NXT1, T7 -tagged | +Inquiry |
| NXT1-29564TH | Recombinant Human NXT1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NXT1-3618HCL | Recombinant Human NXT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NXT1 Products
Required fields are marked with *
My Review for All NXT1 Products
Required fields are marked with *
