Recombinant Human NXT1 protein, T7-tagged

• Cat.No.: NXT1-210H
• Product Overview: Recombinant human NXT1 (140 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 140 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRF QDWAS
• Purity: >90% by SDS-PAGE.
• Applications: 1. May be used for in vitro NXT1 mediated target specific mRNA nuclear export pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NXT1 protein-protein interaction.4. May be used as antigen for specific antibody development.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: NXT1 NTF2-like export factor 1 [ Homo sapiens ]
• Official Symbol: NXT1
• Synonyms: NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15; protein p15
• Gene ID: 29107
• mRNA Refseq: NM_013248
• Protein Refseq: NP_037380
• MIM: 605811
• UniProt ID: Q9UKK6
• Chromosome Location: 20p12-p11.2
• Pathway: Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem
• Function: Ran GTPase binding; protein binding