"NXT1" Related Products

Recombinant Human NXT1 protein, T7-tagged

Cat.No. : NXT1-210H
Product Overview : Recombinant human NXT1 (140 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRF QDWAS
Purity : >90% by SDS-PAGE.
Applications : 1. May be used for in vitro NXT1 mediated target specific mRNA nuclear export pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NXT1 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name : NXT1 NTF2-like export factor 1 [ Homo sapiens ]
Official Symbol : NXT1
Synonyms : NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15; protein p15
Gene ID : 29107
mRNA Refseq : NM_013248
Protein Refseq : NP_037380
MIM : 605811
UniProt ID : Q9UKK6
Chromosome Location : 20p12-p11.2
Pathway : Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function : Ran GTPase binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.