"NXT1" Related Products

Expand

Recombinant Human NXT1 protein, T7-tagged

Cat.No.: NXT1-210H
Product Overview: Recombinant human NXT1 (140 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRF QDWAS
Purity: >90% by SDS-PAGE.
Applications: 1. May be used for in vitro NXT1 mediated target specific mRNA nuclear export pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NXT1 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: NXT1 NTF2-like export factor 1 [ Homo sapiens ]
Official Symbol: NXT1
Synonyms: NXT1; NTF2-like export factor 1; NTX2 like export factor1; NTF2-related export protein 1; MTR2; P15; protein p15
Gene ID: 29107
mRNA Refseq: NM_013248
Protein Refseq: NP_037380
MIM: 605811
UniProt ID: Q9UKK6
Chromosome Location: 20p12-p11.2
Pathway: Exon junction complex (EJC), organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem;
Function: Ran GTPase binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.