Recombinant Human OAS3 protein, His-tagged
Cat.No. : | OAS3-3742H |
Product Overview : | Recombinant Human OAS3 protein(1-350 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | OAS3 2-5-oligoadenylate synthetase 3, 100kDa [ Homo sapiens ] |
Official Symbol | OAS3 |
Synonyms | OAS3; 2-5-oligoadenylate synthetase 3, 100kDa; 2 5 oligoadenylate synthetase 3 (100 kD); 2-5-oligoadenylate synthase 3; p100OAS; p100 OAS; 2-5A synthase 3; 2-5A synthetase 3; (2-5)oligo(A) synthase 3; (2-5)oligo(A) synthetase 3; 2-5oligoadenylate synthetase p100; p100; MGC133260; |
Gene ID | 4940 |
mRNA Refseq | NM_006187 |
Protein Refseq | NP_006178 |
MIM | 603351 |
UniProt ID | Q9Y6K5 |
◆ Recombinant Proteins | ||
OAS3-6296M | Recombinant Mouse OAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
OAS3-11043M | Recombinant Mouse OAS3 Protein | +Inquiry |
OAS3-3807R | Recombinant Rat OAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
OAS3-4145R | Recombinant Rat OAS3 Protein | +Inquiry |
OAS3-1434H | Recombinant Human OAS3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OAS3-3613HCL | Recombinant Human OAS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OAS3 Products
Required fields are marked with *
My Review for All OAS3 Products
Required fields are marked with *