Recombinant Human OCA2

• Cat.No.: OCA2-30532TH
• Product Overview: Recombinant fragment of Human P protein with a N terminal proprietary tag; Predicted MWt 36.63 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV
• Sequence Similarities: Belongs to the CitM (TC 2.A.11) transporter family.

Gene Information

• Gene Name: OCA2 oculocutaneous albinism II [ Homo sapiens ]
• Official Symbol: OCA2
• Synonyms: OCA2; oculocutaneous albinism II; D15S12, EYCL2, EYCL3, eye color 2 (central brown) , eye color 3 (brown) , oculocutaneous albinism II (pink eye dilution (murine) homolog) , oculocutaneous albinism II (pink eye dilution homolog, mouse) , P; P protein
• Gene ID: 4948
• mRNA Refseq: NM_000275
• Protein Refseq: NP_000266
• MIM: 611409
• Uniprot ID: Q04671
• Chromosome Location: 15q11.2-q12
• Function: L-tyrosine transmembrane transporter activity; arsenite transmembrane transporter activity; citrate transmembrane transporter activity; protein binding; transporter activity