Recombinant Human OCA2
Cat.No. : | OCA2-30532TH |
Product Overview : | Recombinant fragment of Human P protein with a N terminal proprietary tag; Predicted MWt 36.63 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV |
Sequence Similarities : | Belongs to the CitM (TC 2.A.11) transporter family. |
Gene Name | OCA2 oculocutaneous albinism II [ Homo sapiens ] |
Official Symbol | OCA2 |
Synonyms | OCA2; oculocutaneous albinism II; D15S12, EYCL2, EYCL3, eye color 2 (central brown) , eye color 3 (brown) , oculocutaneous albinism II (pink eye dilution (murine) homolog) , oculocutaneous albinism II (pink eye dilution homolog, mouse) , P; P protein; |
Gene ID | 4948 |
mRNA Refseq | NM_000275 |
Protein Refseq | NP_000266 |
MIM | 611409 |
Uniprot ID | Q04671 |
Chromosome Location | 15q11.2-q12 |
Function | L-tyrosine transmembrane transporter activity; arsenite transmembrane transporter activity; citrate transmembrane transporter activity; protein binding; transporter activity; |
◆ Recombinant Proteins | ||
OCA2-6306M | Recombinant Mouse OCA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
OCA2-2919H | Recombinant Human OCA2 protein, His-tagged | +Inquiry |
OCA2-11062M | Recombinant Mouse OCA2 Protein | +Inquiry |
OCA2-30532TH | Recombinant Human OCA2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OCA2 Products
Required fields are marked with *
My Review for All OCA2 Products
Required fields are marked with *
0
Inquiry Basket