Recombinant Human OLIG1 Protein (17-105 aa), His-tagged

Cat.No. : OLIG1-2551H
Product Overview : Recombinant Human OLIG1 Protein (17-105 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 17-105 aa
Description : Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.1 kDa
AA Sequence : MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name OLIG1 oligodendrocyte transcription factor 1 [ Homo sapiens ]
Official Symbol OLIG1
Synonyms OLIG1; basic domain; helix loop helix protein; class B; 6; BHLHB6; bHLHe21; oligo1; BHLHE21;
Gene ID 116448
mRNA Refseq NM_138983
Protein Refseq NP_620450
MIM 606385
UniProt ID Q8TAK6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OLIG1 Products

Required fields are marked with *

My Review for All OLIG1 Products

Required fields are marked with *

0
cart-icon