Recombinant Human OLIG1 Protein (17-105 aa), His-tagged

• Cat.No.: OLIG1-2551H
• Product Overview: Recombinant Human OLIG1 Protein (17-105 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 17-105 aa
• Description: Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.1 kDa
• AA Sequence: MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: OLIG1 oligodendrocyte transcription factor 1 [ Homo sapiens ]
• Official Symbol: OLIG1
• Synonyms: OLIG1; basic domain; helix loop helix protein; class B; 6; BHLHB6; bHLHe21; oligo1; BHLHE21
• Gene ID: 116448
• mRNA Refseq: NM_138983
• Protein Refseq: NP_620450
• MIM: 606385
• UniProt ID: Q8TAK6