Recombinant Human OLIG1 Protein (17-105 aa), His-tagged
Cat.No. : | OLIG1-2551H |
Product Overview : | Recombinant Human OLIG1 Protein (17-105 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 17-105 aa |
Description : | Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.1 kDa |
AA Sequence : | MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | OLIG1 oligodendrocyte transcription factor 1 [ Homo sapiens ] |
Official Symbol | OLIG1 |
Synonyms | OLIG1; basic domain; helix loop helix protein; class B; 6; BHLHB6; bHLHe21; oligo1; BHLHE21; |
Gene ID | 116448 |
mRNA Refseq | NM_138983 |
Protein Refseq | NP_620450 |
MIM | 606385 |
UniProt ID | Q8TAK6 |
◆ Recombinant Proteins | ||
OLIG1-779H | Recombinant Human OLIG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OLIG1-1454H | Recombinant Human OLIG1, GST-tagged | +Inquiry |
OLIG1-3831R | Recombinant Rat OLIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OLIG1-1425HFL | Recombinant Full Length Human OLIG1 Protein, C-Flag-tagged | +Inquiry |
OLIG1-2551H | Recombinant Human OLIG1 Protein (17-105 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG1-3577HCL | Recombinant Human OLIG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLIG1 Products
Required fields are marked with *
My Review for All OLIG1 Products
Required fields are marked with *