Recombinant Human OLR1 protein(61-150 aa), C-His-tagged
Cat.No. : | OLR1-2808H |
Product Overview : | Recombinant Human OLR1 protein(P78380)(61-150 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-150 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 12 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIW |
Gene Name | OLR1 oxidized low density lipoprotein (lectin-like) receptor 1 [ Homo sapiens ] |
Official Symbol | OLR1 |
Synonyms | OLR1; oxidized low density lipoprotein (lectin-like) receptor 1; oxidised low density lipoprotein (lectin like) receptor 1; oxidized low-density lipoprotein receptor 1; CLEC8A; LOX 1; SCARE1; hLOX-1; ox LDL receptor 1; lectin-type oxidized LDL receptor 1; scavenger receptor class E, member 1; C-type lectin domain family 8 member A; oxidized low-density lipoprotein receptor 1, soluble form; LOX1; LOXIN; SLOX1; |
Gene ID | 4973 |
mRNA Refseq | NM_001172632 |
Protein Refseq | NP_001166103 |
MIM | 602601 |
UniProt ID | P78380 |
◆ Recombinant Proteins | ||
Olr1-358M | Recombinant Mouse Olr1 Protein, MYC/DDK-tagged | +Inquiry |
OLR1-4768H | Recombinant Human OLR1 Protein (Leu81-Gln273), N-His tagged | +Inquiry |
OLR1-2382R | Recombinant Rat OLR1 protein(Leu60-Gln364), hFc-tagged | +Inquiry |
OLR1-2451H | Recombinant Human Oxidized Low Density Lipoprotein (Lectin-like) Receptor 1 | +Inquiry |
OLR1-3306H | Recombinant Human OLR1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLR1-1716HCL | Recombinant Human OLR1 cell lysate | +Inquiry |
OLR1-001RCL | Recombinant Rat OLR1 cell lysate | +Inquiry |
OLR1-1170CCL | Recombinant Cynomolgus OLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLR1 Products
Required fields are marked with *
My Review for All OLR1 Products
Required fields are marked with *