Recombinant Human OLR1 protein(61-150 aa), C-His-tagged

Cat.No. : OLR1-2808H
Product Overview : Recombinant Human OLR1 protein(P78380)(61-150 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 61-150 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 12 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIW
Gene Name OLR1 oxidized low density lipoprotein (lectin-like) receptor 1 [ Homo sapiens ]
Official Symbol OLR1
Synonyms OLR1; oxidized low density lipoprotein (lectin-like) receptor 1; oxidised low density lipoprotein (lectin like) receptor 1; oxidized low-density lipoprotein receptor 1; CLEC8A; LOX 1; SCARE1; hLOX-1; ox LDL receptor 1; lectin-type oxidized LDL receptor 1; scavenger receptor class E, member 1; C-type lectin domain family 8 member A; oxidized low-density lipoprotein receptor 1, soluble form; LOX1; LOXIN; SLOX1;
Gene ID 4973
mRNA Refseq NM_001172632
Protein Refseq NP_001166103
MIM 602601
UniProt ID P78380

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OLR1 Products

Required fields are marked with *

My Review for All OLR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon