Recombinant Human ONECUT2 protein, His-tagged
| Cat.No. : | ONECUT2-3539H |
| Product Overview : | Recombinant Human ONECUT2 protein(226-332 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | June 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 226-332 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | ONECUT2 |
| Synonyms | ONECUT2; one cut homeobox 2; one cut domain, family member 2; one cut domain family member 2; OC 2; onecut 2; HNF-6-beta; transcription factor ONECUT-2; hepatocyte nuclear factor 6-beta; ONECUT-2 homeodomain transcription factor; OC2; OC-2; MGC120377; MGC120378; |
| Gene ID | 9480 |
| mRNA Refseq | NM_004852 |
| Protein Refseq | NP_004843 |
| MIM | 604894 |
| UniProt ID | O95948 |
| ◆ Recombinant Proteins | ||
| ONECUT2-6392M | Recombinant Mouse ONECUT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ONECUT2-19HCL | Recombinant Human ONECUT2 HEK293T cell lysate | +Inquiry |
| ONECUT2-1459H | Recombinant Human ONECUT2, GST-tagged | +Inquiry |
| ONECUT2-3539H | Recombinant Human ONECUT2 protein, His-tagged | +Inquiry |
| ONECUT2-3540H | Recombinant Human ONECUT2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ONECUT2 Products
Required fields are marked with *
My Review for All ONECUT2 Products
Required fields are marked with *
