Recombinant Human ONECUT2 protein, His-tagged

Cat.No. : ONECUT2-3539H
Product Overview : Recombinant Human ONECUT2 protein(226-332 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability July 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 226-332 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : PLAATPLGNGLGGLHNAQQSLPNYGPPGHDKMLSPNFDAHHTAMLTRGEQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHGPVLAPSRERPPSSSSGSQVATSGQLEE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol ONECUT2
Synonyms ONECUT2; one cut homeobox 2; one cut domain, family member 2; one cut domain family member 2; OC 2; onecut 2; HNF-6-beta; transcription factor ONECUT-2; hepatocyte nuclear factor 6-beta; ONECUT-2 homeodomain transcription factor; OC2; OC-2; MGC120377; MGC120378;
Gene ID 9480
mRNA Refseq NM_004852
Protein Refseq NP_004843
MIM 604894
UniProt ID O95948

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ONECUT2 Products

Required fields are marked with *

My Review for All ONECUT2 Products

Required fields are marked with *

0
cart-icon