Recombinant Human OPN3 Full Length Transmembrane protein, His-tagged
Cat.No. : | OPN3-5940H |
Product Overview : | Recombinant Human OPN3 protein(Q9H1Y3)(1-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-402aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.7 kDa |
AA Sequence : | MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | OPN3 opsin 3 [ Homo sapiens ] |
Official Symbol | OPN3 |
Synonyms | OPN3; opsin 3; ECPN, encephalopsin; opsin-3; encephalopsin; ERO; NMO 1; panopsin; opsin 3 (encephalopsin, panopsin); ECPN; |
Gene ID | 23596 |
mRNA Refseq | NM_014322 |
Protein Refseq | NP_055137 |
MIM | 606695 |
UniProt ID | Q9H1Y3 |
◆ Recombinant Proteins | ||
RFL19574HF | Recombinant Full Length Human Opsin-3(Opn3) Protein, His-Tagged | +Inquiry |
OPN3-5940H | Recombinant Human OPN3 Full Length Transmembrane protein, His-tagged | +Inquiry |
OPN3-6399M | Recombinant Mouse OPN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
OPN3-6232Z | Recombinant Zebrafish OPN3 | +Inquiry |
RFL35486MF | Recombinant Full Length Mouse Opsin-3(Opn3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OPN3 Products
Required fields are marked with *
My Review for All OPN3 Products
Required fields are marked with *