Recombinant Human OR2H1 protein, GST-tagged
Cat.No. : | OR2H1-7877H |
Product Overview : | Recombinant Human OR2H1 protein(128-170 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 128-170 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | OR2H1 olfactory receptor, family 2, subfamily H, member 1 [ Homo sapiens ] |
Official Symbol | OR2H1 |
Synonyms | OR2H1; olfactory receptor, family 2, subfamily H, member 1; olfactory receptor, family 2, subfamily H, member 8 , OR2H6, OR2H8; olfactory receptor 2H1; OR6 2; OLFR42A-9004.14/9026.2; olfactory receptor 2H6; olfactory receptor 2H8; olfactory receptor 6-2; olfactory receptor OR6-32; olfactory receptor, family 2, subfamily H, member 6; olfactory receptor, family 2, subfamily H, member 8; OR2H6; OR2H8; OR6-2; 6M1-16; HS6M1-16; dJ994E9.4; OLFR42A-9004-14; |
mRNA Refseq | NM_030883 |
Protein Refseq | NP_112145 |
UniProt ID | Q9GZK4 |
Gene ID | 26716 |
◆ Recombinant Proteins | ||
RFL4709HF | Recombinant Full Length Human Olfactory Receptor 2H1(Or2H1) Protein, His-Tagged | +Inquiry |
OR2H1-7877H | Recombinant Human OR2H1 protein, GST-tagged | +Inquiry |
OR2H1-2947H | Active Recombinant Human OR2H1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
OR2H1-7876H | Recombinant Human OR2H1 protein, His-tagged | +Inquiry |
OR2H1-301249H | Recombinant Human OR2H1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OR2H1-3563HCL | Recombinant Human OR2H1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR2H1 Products
Required fields are marked with *
My Review for All OR2H1 Products
Required fields are marked with *
0
Inquiry Basket