Recombinant Human OR2H1 protein, GST-tagged
| Cat.No. : | OR2H1-301249H |
| Product Overview : | Recombinant Human OR2H1 (128-170 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Leu128-Gln170 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | OR2H1 olfactory receptor, family 2, subfamily H, member 1 [ Homo sapiens ] |
| Official Symbol | OR2H1 |
| Synonyms | OR2H1; olfactory receptor, family 2, subfamily H, member 1; olfactory receptor, family 2, subfamily H, member 8 , OR2H6, OR2H8; olfactory receptor 2H1; OR6 2; OLFR42A-9004.14/9026.2; olfactory receptor 2H6; olfactory receptor 2H8; olfactory receptor 6-2; olfactory receptor OR6-32; olfactory receptor, family 2, subfamily H, member 6; olfactory receptor, family 2, subfamily H, member 8; OR2H6; OR2H8; OR6-2; 6M1-16; HS6M1-16; dJ994E9.4; OLFR42A-9004-14; |
| Gene ID | 26716 |
| mRNA Refseq | NM_030883 |
| Protein Refseq | NP_112145 |
| UniProt ID | Q9GZK4 |
| ◆ Recombinant Proteins | ||
| OR2H1-301249H | Recombinant Human OR2H1 protein, GST-tagged | +Inquiry |
| OR2H1-2947H | Active Recombinant Human OR2H1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| RFL4709HF | Recombinant Full Length Human Olfactory Receptor 2H1(Or2H1) Protein, His-Tagged | +Inquiry |
| OR2H1-7876H | Recombinant Human OR2H1 protein, His-tagged | +Inquiry |
| OR2H1-7877H | Recombinant Human OR2H1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OR2H1-3563HCL | Recombinant Human OR2H1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OR2H1 Products
Required fields are marked with *
My Review for All OR2H1 Products
Required fields are marked with *
