Recombinant Human OR2H1 protein, GST-tagged

Cat.No. : OR2H1-301249H
Product Overview : Recombinant Human OR2H1 (128-170 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Leu128-Gln170
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : LHYATIIHPRLCWQLASVAWVMSLVQSIVQTPSTLHLPFCPHQ
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name OR2H1 olfactory receptor, family 2, subfamily H, member 1 [ Homo sapiens ]
Official Symbol OR2H1
Synonyms OR2H1; olfactory receptor, family 2, subfamily H, member 1; olfactory receptor, family 2, subfamily H, member 8 , OR2H6, OR2H8; olfactory receptor 2H1; OR6 2; OLFR42A-9004.14/9026.2; olfactory receptor 2H6; olfactory receptor 2H8; olfactory receptor 6-2; olfactory receptor OR6-32; olfactory receptor, family 2, subfamily H, member 6; olfactory receptor, family 2, subfamily H, member 8; OR2H6; OR2H8; OR6-2; 6M1-16; HS6M1-16; dJ994E9.4; OLFR42A-9004-14;
Gene ID 26716
mRNA Refseq NM_030883
Protein Refseq NP_112145
UniProt ID Q9GZK4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OR2H1 Products

Required fields are marked with *

My Review for All OR2H1 Products

Required fields are marked with *

0
cart-icon
0
compare icon