Recombinant Human ORAI1 protein, His-tagged
| Cat.No. : | ORAI1-3265H |
| Product Overview : | Recombinant Human ORAI1 protein(1-75 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-75 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ORAI1 ORAI calcium release-activated calcium modulator 1 [ Homo sapiens ] |
| Official Symbol | ORAI1 |
| Synonyms | ORAI1; ORAI calcium release-activated calcium modulator 1; TMEM142A, transmembrane protein 142A; calcium release-activated calcium channel protein 1; calcium release activated calcium modulator 1; CRACM1; FLJ14466; protein orai-1; transmembrane protein 142A; calcium release-activated calcium modulator 1; ORAT1; TMEM142A; |
| Gene ID | 84876 |
| mRNA Refseq | NM_032790 |
| Protein Refseq | NP_116179 |
| MIM | 610277 |
| UniProt ID | Q96D31 |
| ◆ Recombinant Proteins | ||
| ORAI1-3767H | Recombinant Human ORAI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ORAI1-2364C | Recombinant Chicken ORAI1 | +Inquiry |
| ORAI1-301514H | Recombinant Human ORAI1 protein, GST-tagged | +Inquiry |
| RFL29240XF | Recombinant Full Length Xenopus Laevis Calcium Release-Activated Calcium Channel Protein 1(Orai1) Protein, His-Tagged | +Inquiry |
| ORAI1-3265H | Recombinant Human ORAI1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORAI1 Products
Required fields are marked with *
My Review for All ORAI1 Products
Required fields are marked with *
