Recombinant Human OTOR
| Cat.No. : | OTOR-28850TH |
| Product Overview : | Recombinant full length Human Otoraplin ; 111 amino acids, predicted MWt 12.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 111 amino acids |
| Description : | The protein encoded by this gene is secreted via the Golgi apparatus and may function in cartilage development and maintenance. A frequent polymorphism in the translation start codon of this gene can abolish translation and may be associated with forms of deafness. This gene is a member of the melanoma-inhibiting activity gene family. In addition, alternate polyA sites exist for this gene. |
| Molecular Weight : | 12.700kDa |
| Tissue specificity : | Highly expressed in cochlea. |
| Form : | Lyophilised:Reconstitute the lyophilized Otoraplin in 50ul sterile ultra pure. |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 7.40Constituents:0.19% PBS, 0.75% Sodium chloride |
| Storage : | Please see Notes section |
| Sequences of amino acids : | VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRF INVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVV GYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
| Sequence Similarities : | Belongs to the MIA/OTOR family.Contains 1 SH3 domain. |
| Gene Name | OTOR otoraplin [ Homo sapiens ] |
| Official Symbol | OTOR |
| Synonyms | OTOR; otoraplin; FDP; MIAL; MIAL1; |
| Gene ID | 56914 |
| mRNA Refseq | NM_020157 |
| Protein Refseq | NP_064542 |
| MIM | 606067 |
| Uniprot ID | Q9NRC9 |
| Chromosome Location | 20p12.1-p11.23 |
| ◆ Recombinant Proteins | ||
| Otor-4675M | Recombinant Mouse Otor protein, His-tagged | +Inquiry |
| OTOR-6297C | Recombinant Chicken OTOR | +Inquiry |
| OTOR-210O | Recombinant Human OTOR Protein (111 aa) | +Inquiry |
| OTOR-1477H | Recombinant Human OTOR, GST-tagged | +Inquiry |
| OTOR-063O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTOR Products
Required fields are marked with *
My Review for All OTOR Products
Required fields are marked with *
