Recombinant Human OTOR protein
Cat.No. : | OTOR-4933H |
Product Overview : | Recombinant Human OTOR protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 111 |
Description : | OTOR also named Otoraplin and MIAL, is a 15 kDa disulfide bonded homodimer, which is secreted via the Golgi apparatus and is a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is mainly expressed in the cochlea of the inner-ear and appears to be involved in early chondrogenesis of the otic capsule, which is required for normal inner ear development and auditory function. The OTOR shares high sequence identity with the mouse (90%), chicken (80%), and bullfrog (60%) orthologs and with the related human CDRAP/MIA protein (43%). |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150mM NaCl. |
Molecular Mass : | Approximately 12.7 kDa, a single non-glycosylated polypeptide chain containing 111 amino acids. |
AA Sequence : | VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
Endotoxin : | Less than 1 EU/µg of rHuOTOR as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | OTOR |
Official Symbol | OTOR |
Synonyms | OTOR; otoraplin; FDP; MIAL; MIAL1; fibrocyte-derived protein; melanoma inhibitory activity-like protein; MGC126737; MGC126739; |
Gene ID | 56914 |
mRNA Refseq | NM_020157 |
Protein Refseq | NP_064542 |
MIM | 606067 |
UniProt ID | Q9NRC9 |
◆ Recombinant Proteins | ||
OTOR-4933H | Recombinant Human OTOR protein | +Inquiry |
OTOR-28851TH | Recombinant Human OTOR | +Inquiry |
OTOR-318O | Recombinant Human OTOR Protein (112 aa) | +Inquiry |
OTOR-28850TH | Recombinant Human OTOR | +Inquiry |
Otor-4675M | Recombinant Mouse Otor protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTOR-3518HCL | Recombinant Human OTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTOR Products
Required fields are marked with *
My Review for All OTOR Products
Required fields are marked with *
0
Inquiry Basket