Recombinant Human OTX2 protein, T7/His-tagged
| Cat.No. : | OTX2-193H |
| Product Overview : | Recombinant human OTX2 (2 - 297 aa, Isoform-I, derived from BC032579) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 2-297 a.a. |
| Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEFMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRR ERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKT SPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYA GSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTAS WKLNFNADCLDYKDQTSSWKFQVL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | OTX2 orthodenticle homeobox 2 [ Homo sapiens ] |
| Official Symbol | OTX2 |
| Synonyms | OTX2; orthodenticle homeobox 2; orthodenticle homolog 2 (Drosophila); homeobox protein OTX2; orthodenticle homolog 2; CPHD6; MCOPS5; MGC45000; |
| Gene ID | 5015 |
| mRNA Refseq | NM_021728 |
| Protein Refseq | NP_068374 |
| MIM | 600037 |
| UniProt ID | P32243 |
| Chromosome Location | 14q22.3 |
| Function | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; eukaryotic initiation factor 4E binding; protein binding; sequence-specific DNA binding; sequence |
| ◆ Recombinant Proteins | ||
| OTX2-25H | Recombinant Human OTX2 Protein, His-tagged | +Inquiry |
| OTX2-26H | Recombinant Human OTX2 Protein, His-tagged | +Inquiry |
| OTX2-8848Z | Recombinant Zebrafish OTX2 | +Inquiry |
| OTX2-3310H | Recombinant Human OTX2 protein, His-SUMO-tagged | +Inquiry |
| OTX2-4776H | Recombinant Human OTX2 Protein (Met1-Leu297), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OTX2-3511HCL | Recombinant Human OTX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTX2 Products
Required fields are marked with *
My Review for All OTX2 Products
Required fields are marked with *
