Recombinant Human OTX2 protein, T7/His-tagged

Cat.No. : OTX2-193H
Product Overview : Recombinant human OTX2 (2 - 297 aa, Isoform-I, derived from BC032579) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-297 a.a.
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGEFMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRR ERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKT SPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYA GSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTAS WKLNFNADCLDYKDQTSSWKFQVL
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name OTX2 orthodenticle homeobox 2 [ Homo sapiens ]
Official Symbol OTX2
Synonyms OTX2; orthodenticle homeobox 2; orthodenticle homolog 2 (Drosophila); homeobox protein OTX2; orthodenticle homolog 2; CPHD6; MCOPS5; MGC45000;
Gene ID 5015
mRNA Refseq NM_021728
Protein Refseq NP_068374
MIM 600037
UniProt ID P32243
Chromosome Location 14q22.3
Function RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; eukaryotic initiation factor 4E binding; protein binding; sequence-specific DNA binding; sequence

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OTX2 Products

Required fields are marked with *

My Review for All OTX2 Products

Required fields are marked with *

0
cart-icon