Recombinant Human OXT Protein (32-125 aa), His-tagged
Cat.No. : | OXT-2240H |
Product Overview : | Recombinant Human OXT Protein (32-125 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 32-125 aa |
Description : | Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 11.6 kDa |
AA Sequence : | AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | OXT oxytocin, prepropeptide [ Homo sapiens ] |
Official Symbol | OXT |
Synonyms | OXT; oxytocin-neurophysin 1; neurophysin I; OT; OT-NPI; MGC126890; MGC126892; |
Gene ID | 5020 |
mRNA Refseq | NM_000915 |
Protein Refseq | NP_000906 |
MIM | 167050 |
UniProt ID | P01178 |
◆ Recombinant Proteins | ||
Oxt-8226M | Recombinant Mouse Oxt protein, His & T7-tagged | +Inquiry |
OXT-1488H | Recombinant Human OXT, GST-tagged | +Inquiry |
OXT-2240H | Recombinant Human OXT Protein (32-125 aa), His-tagged | +Inquiry |
Oxt-8227R | Recombinant Rat Oxt protein, His & T7-tagged | +Inquiry |
OxT-3313H | Recombinant Human OxT protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
OXT-3503HCL | Recombinant Human OXT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OXT Products
Required fields are marked with *
My Review for All OXT Products
Required fields are marked with *