Recombinant Human OXT Protein (32-125 aa), His-tagged

• Cat.No.: OXT-2240H
• Product Overview: Recombinant Human OXT Protein (32-125 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 32-125 aa
• Description: Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.6 kDa
• AA Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: OXT oxytocin, prepropeptide [ Homo sapiens ]
• Official Symbol: OXT
• Synonyms: OXT; oxytocin-neurophysin 1; neurophysin I; OT; OT-NPI; MGC126890; MGC126892
• Gene ID: 5020
• mRNA Refseq: NM_000915
• Protein Refseq: NP_000906
• MIM: 167050
• UniProt ID: P01178