Recombinant Human OXT Protein (32-125 aa), His-tagged

Cat.No. : OXT-2240H
Product Overview : Recombinant Human OXT Protein (32-125 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 32-125 aa
Description : Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.6 kDa
AA Sequence : AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name OXT oxytocin, prepropeptide [ Homo sapiens ]
Official Symbol OXT
Synonyms OXT; oxytocin-neurophysin 1; neurophysin I; OT; OT-NPI; MGC126890; MGC126892;
Gene ID 5020
mRNA Refseq NM_000915
Protein Refseq NP_000906
MIM 167050
UniProt ID P01178

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OXT Products

Required fields are marked with *

My Review for All OXT Products

Required fields are marked with *

0
cart-icon