Recombinant Human OxT protein, His&Myc-tagged
| Cat.No. : | OxT-3313H |
| Product Overview : | Recombinant Human OxT protein(P01178)(32-125aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 32-125aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.6 kDa |
| AA Sequence : | AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | OXT oxytocin, prepropeptide [ Homo sapiens ] |
| Official Symbol | OxT |
| Synonyms | OXT; oxytocin, prepropeptide; OT, oxytocin, prepro (neurophysin I); oxytocin-neurophysin 1; neurophysin I; oxytocin, prepro- (neurophysin I); oxytocin-neurophysin I, preproprotein; OT; OT-NPI; MGC126890; MGC126892; |
| Gene ID | 5020 |
| mRNA Refseq | NM_000915 |
| Protein Refseq | NP_000906 |
| MIM | 167050 |
| UniProt ID | P01178 |
| ◆ Recombinant Proteins | ||
| OXT-1488H | Recombinant Human OXT, GST-tagged | +Inquiry |
| OXT-8225H | Recombinant Human OXT protein, His-tagged | +Inquiry |
| OXT-6455M | Recombinant Mouse OXT Protein, His (Fc)-Avi-tagged | +Inquiry |
| Oxt-4634M | Recombinant Mouse Oxt Protein, Myc/DDK-tagged | +Inquiry |
| OxT-3313H | Recombinant Human OxT protein, His&Myc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OXT-3503HCL | Recombinant Human OXT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OxT Products
Required fields are marked with *
My Review for All OxT Products
Required fields are marked with *
