Recombinant Human P2RX3

Cat.No. : P2RX3-30538TH
Product Overview : Recombinant fragment corresponding to amino acids 45-154 of Human P2X3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and may transduce ATP-evoked nociceptor activation. Mouse studies suggest that this receptor is important for peripheral pain responses, and also participates in pathways controlling urinary bladder volume reflexes. It is possible that the development of selective antagonists for this receptor may have a therapeutic potential in pain relief and in the treatment of disorders of urine storage.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPP QGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGP ERLPGGGILTGRCVNYSSVLRTCEIQGWCP
Sequence Similarities : Belongs to the P2X receptor family.
Gene Name P2RX3 purinergic receptor P2X, ligand-gated ion channel, 3 [ Homo sapiens ]
Official Symbol P2RX3
Synonyms P2RX3; purinergic receptor P2X, ligand-gated ion channel, 3; P2X purinoceptor 3; P2X3;
Gene ID 5024
mRNA Refseq NM_002559
Protein Refseq NP_002550
MIM 600843
Uniprot ID P56373
Chromosome Location 11q12
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function ATP binding; extracellular ATP-gated cation channel activity; extracellular ATP-gated cation channel activity; ion channel activity; purinergic nucleotide receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All P2RX3 Products

Required fields are marked with *

My Review for All P2RX3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon