Recombinant Human P2RX3

• Cat.No.: P2RX3-30538TH
• Product Overview: Recombinant fragment corresponding to amino acids 45-154 of Human P2X3 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Description: The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and may transduce ATP-evoked nociceptor activation. Mouse studies suggest that this receptor is important for peripheral pain responses, and also participates in pathways controlling urinary bladder volume reflexes. It is possible that the development of selective antagonists for this receptor may have a therapeutic potential in pain relief and in the treatment of disorders of urine storage.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPP QGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGP ERLPGGGILTGRCVNYSSVLRTCEIQGWCP
• Sequence Similarities: Belongs to the P2X receptor family.
• Tag: Non

Gene Information

• Gene Name: P2RX3 purinergic receptor P2X, ligand-gated ion channel, 3 [ Homo sapiens ]
• Official Symbol: P2RX3
• Synonyms: P2RX3; purinergic receptor P2X, ligand-gated ion channel, 3; P2X purinoceptor 3; P2X3
• Gene ID: 5024
• mRNA Refseq: NM_002559
• Protein Refseq: NP_002550
• MIM: 600843
• Uniprot ID: P56373
• Chromosome Location: 11q12
• Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem
• Function: ATP binding; extracellular ATP-gated cation channel activity; extracellular ATP-gated cation channel activity; ion channel activity; purinergic nucleotide receptor activity