Recombinant Human P2RY6
Cat.No. : | P2RY6-30535TH |
Product Overview : | Recombinant fragment of Human P2Y6 with N terminal proprietary tag, 36.85 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 102 amino acids |
Description : | The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. Four transcript variants encoding the same isoform have been identified for this gene. |
Molecular Weight : | 36.850kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAG LPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLP LLIYNYAQGDHWPFGDFACRLV |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | P2RY6 pyrimidinergic receptor P2Y, G-protein coupled, 6 [ Homo sapiens ] |
Official Symbol | P2RY6 |
Synonyms | P2RY6; pyrimidinergic receptor P2Y, G-protein coupled, 6; P2Y purinoceptor 6; P2Y6; |
Gene ID | 5031 |
mRNA Refseq | NM_004154 |
Protein Refseq | NP_004145 |
MIM | 602451 |
Uniprot ID | Q15077 |
Chromosome Location | 11q13.5 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function | G-protein coupled purinergic nucleotide receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
RFL25172HF | Recombinant Full Length Human P2Y Purinoceptor 6(P2Ry6) Protein, His-Tagged | +Inquiry |
P2RY6-4239R | Recombinant Rat P2RY6 Protein | +Inquiry |
P2RY6-6749C | Recombinant Chicken P2RY6 | +Inquiry |
P2RY6-30535TH | Recombinant Human P2RY6 | +Inquiry |
P2RY6-3901R | Recombinant Rat P2RY6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RY6-3484HCL | Recombinant Human P2RY6 293 Cell Lysate | +Inquiry |
P2RY6-3485HCL | Recombinant Human P2RY6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All P2RY6 Products
Required fields are marked with *
My Review for All P2RY6 Products
Required fields are marked with *
0
Inquiry Basket