Recombinant Human P2RY6

Cat.No. : P2RY6-30535TH
Product Overview : Recombinant fragment of Human P2Y6 with N terminal proprietary tag, 36.85 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 102 amino acids
Description : The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. Four transcript variants encoding the same isoform have been identified for this gene.
Molecular Weight : 36.850kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAG LPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLP LLIYNYAQGDHWPFGDFACRLV
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name P2RY6 pyrimidinergic receptor P2Y, G-protein coupled, 6 [ Homo sapiens ]
Official Symbol P2RY6
Synonyms P2RY6; pyrimidinergic receptor P2Y, G-protein coupled, 6; P2Y purinoceptor 6; P2Y6;
Gene ID 5031
mRNA Refseq NM_004154
Protein Refseq NP_004145
MIM 602451
Uniprot ID Q15077
Chromosome Location 11q13.5
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function G-protein coupled purinergic nucleotide receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All P2RY6 Products

Required fields are marked with *

My Review for All P2RY6 Products

Required fields are marked with *

0
cart-icon