Recombinant Human PABPC4 protein, His-tagged

Cat.No. : PABPC4-1504H
Product Overview : Recombinant Human PABPC4 protein(285-631 aa), fused with His tag, was expressed in E.coli.
Availability September 02, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 285-631 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PABPC4 poly(A) binding protein, cytoplasmic 4 (inducible form) [ Homo sapiens ]
Official Symbol PABPC4
Synonyms PABPC4; poly(A) binding protein, cytoplasmic 4 (inducible form); polyadenylate-binding protein 4; APP 1; iPABP; PABP-4; poly(A)-binding protein 4; activated-platelet protein 1; inducible poly(A)-binding protein; APP1; APP-1; PABP4; FLJ43938;
Gene ID 8761
mRNA Refseq NM_001135653
Protein Refseq NP_001129125
MIM 603407
UniProt ID Q13310

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PABPC4 Products

Required fields are marked with *

My Review for All PABPC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon