Recombinant Human PABPC4 protein, His-tagged
| Cat.No. : | PABPC4-1504H |
| Product Overview : | Recombinant Human PABPC4 protein(285-631 aa), fused with His tag, was expressed in E.coli. |
| Availability | November 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 285-631 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PABPC4 poly(A) binding protein, cytoplasmic 4 (inducible form) [ Homo sapiens ] |
| Official Symbol | PABPC4 |
| Synonyms | PABPC4; poly(A) binding protein, cytoplasmic 4 (inducible form); polyadenylate-binding protein 4; APP 1; iPABP; PABP-4; poly(A)-binding protein 4; activated-platelet protein 1; inducible poly(A)-binding protein; APP1; APP-1; PABP4; FLJ43938; |
| Gene ID | 8761 |
| mRNA Refseq | NM_001135653 |
| Protein Refseq | NP_001129125 |
| MIM | 603407 |
| UniProt ID | Q13310 |
| ◆ Recombinant Proteins | ||
| PABPC4-4390H | Recombinant Human PABPC4 protein | +Inquiry |
| PABPC4-1504H | Recombinant Human PABPC4 protein, His-tagged | +Inquiry |
| PABPC4-11444Z | Recombinant Zebrafish PABPC4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PABPC4-1271HCL | Recombinant Human PABPC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PABPC4 Products
Required fields are marked with *
My Review for All PABPC4 Products
Required fields are marked with *
