Recombinant Human PABPC4 protein, His-tagged
Cat.No. : | PABPC4-1504H |
Product Overview : | Recombinant Human PABPC4 protein(285-631 aa), fused with His tag, was expressed in E.coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 285-631 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PABPC4 poly(A) binding protein, cytoplasmic 4 (inducible form) [ Homo sapiens ] |
Official Symbol | PABPC4 |
Synonyms | PABPC4; poly(A) binding protein, cytoplasmic 4 (inducible form); polyadenylate-binding protein 4; APP 1; iPABP; PABP-4; poly(A)-binding protein 4; activated-platelet protein 1; inducible poly(A)-binding protein; APP1; APP-1; PABP4; FLJ43938; |
Gene ID | 8761 |
mRNA Refseq | NM_001135653 |
Protein Refseq | NP_001129125 |
MIM | 603407 |
UniProt ID | Q13310 |
◆ Recombinant Proteins | ||
PABPC4-4390H | Recombinant Human PABPC4 protein | +Inquiry |
PABPC4-1504H | Recombinant Human PABPC4 protein, His-tagged | +Inquiry |
PABPC4-11444Z | Recombinant Zebrafish PABPC4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PABPC4-1271HCL | Recombinant Human PABPC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PABPC4 Products
Required fields are marked with *
My Review for All PABPC4 Products
Required fields are marked with *