Recombinant Human PABPC5 protein, His-tagged
| Cat.No. : | PABPC5-6744H |
| Product Overview : | Recombinant Human PABPC5 protein(1-68 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-68 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PABPC5 poly(A) binding protein, cytoplasmic 5 [ Homo sapiens ] |
| Official Symbol | PABPC5 |
| Synonyms | PABPC5; poly(A) binding protein, cytoplasmic 5; polyadenylate-binding protein 5; PABP5; FLJ51677; |
| Gene ID | 140886 |
| mRNA Refseq | NM_080832 |
| Protein Refseq | NP_543022 |
| MIM | 300407 |
| UniProt ID | Q96DU9 |
| ◆ Recombinant Proteins | ||
| PABPC5-205H | Recombinant Human PABPC5 Protein, His-tagged | +Inquiry |
| PABPC5-6745H | Recombinant Human PABPC5 protein, His-tagged | +Inquiry |
| PABPC5-6744H | Recombinant Human PABPC5 protein, His-tagged | +Inquiry |
| PABPC5-3278R | Recombinant Rhesus monkey PABPC5 Protein, His-tagged | +Inquiry |
| PABPC5-3096R | Recombinant Rhesus Macaque PABPC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PABPC5-3476HCL | Recombinant Human PABPC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PABPC5 Products
Required fields are marked with *
My Review for All PABPC5 Products
Required fields are marked with *
