Recombinant Human PABPC5 protein, His-tagged
Cat.No. : | PABPC5-6745H |
Product Overview : | Recombinant Human PABPC5 protein(275-350 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 275-350 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QKKIERLAELRRRFERLRLKEKSRPPGVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PABPC5 poly(A) binding protein, cytoplasmic 5 [ Homo sapiens ] |
Official Symbol | PABPC5 |
Synonyms | PABPC5; poly(A) binding protein, cytoplasmic 5; polyadenylate-binding protein 5; PABP5; FLJ51677; |
Gene ID | 140886 |
mRNA Refseq | NM_080832 |
Protein Refseq | NP_543022 |
MIM | 300407 |
UniProt ID | Q96DU9 |
◆ Recombinant Proteins | ||
PABPC5-205H | Recombinant Human PABPC5 Protein, His-tagged | +Inquiry |
PABPC5-6744H | Recombinant Human PABPC5 protein, His-tagged | +Inquiry |
PABPC5-3278R | Recombinant Rhesus monkey PABPC5 Protein, His-tagged | +Inquiry |
PABPC5-3096R | Recombinant Rhesus Macaque PABPC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PABPC5-6745H | Recombinant Human PABPC5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PABPC5-3476HCL | Recombinant Human PABPC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PABPC5 Products
Required fields are marked with *
My Review for All PABPC5 Products
Required fields are marked with *