Recombinant Human PAFAH2 protein, His-tagged
Cat.No. : | PAFAH2-6854H |
Product Overview : | Recombinant Human PAFAH2 protein(165-392 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 165-392 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | WIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PAFAH2 platelet-activating factor acetylhydrolase 2, 40kDa [ Homo sapiens ] |
Official Symbol | PAFAH2 |
Synonyms | PAFAH2; platelet-activating factor acetylhydrolase 2, 40kDa; platelet activating factor acetylhydrolase 2 (40kD); platelet-activating factor acetylhydrolase 2, cytoplasmic; HSD PLA2; SD-PLA2; serine-dependent phospholipase A2; HSD-PLA2; FLJ26025; |
Gene ID | 5051 |
mRNA Refseq | NM_000437 |
Protein Refseq | NP_000428 |
MIM | 602344 |
UniProt ID | Q99487 |
◆ Recombinant Proteins | ||
PAFAH2-2119H | Recombinant Human PAFAH2 protein, His & T7-tagged | +Inquiry |
PAFAH2-6854H | Recombinant Human PAFAH2 protein, His-tagged | +Inquiry |
PAFAH2-4256R | Recombinant Rat PAFAH2 Protein | +Inquiry |
PAFAH2-039H | Recombinant Human PAFAH2 Protein, His-tagged | +Inquiry |
Pafah2-021M | Recombinant Mouse Pafah2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAFAH2-3466HCL | Recombinant Human PAFAH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAFAH2 Products
Required fields are marked with *
My Review for All PAFAH2 Products
Required fields are marked with *