Recombinant Human PAG1 Protein, His tagged

• Cat.No.: PAG1-001H
• Product Overview: Recombinant Human PAG1 Protein (38-432 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 38-432 aa
• Description: The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation.
• Molecular Mass: 44 kDa
• AASequence: MSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRLHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: >90% estimated by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.88 mg/mL by BCA

Gene Information

• Gene Name: PAG1 phosphoprotein membrane anchor with glycosphingolipid microdomains 1 [ Homo sapiens (human) ]
• Official Symbol: PAG1
• Synonyms: PAG1; phosphoprotein associated with glycosphingolipid microdomains 1; phosphoprotein associated with glycosphingolipid-enriched microdomains 1; CBP; Csk binding protein; PAG; transmembrane adaptor protein PAG; Csk-binding protein; transmembrane phosphoprotein Cbp; transmembrane adapter protein PAG; FLJ37858; MGC138364
• Gene ID: 55824
• mRNA Refseq: NM_018440
• Protein Refseq: NP_060910
• MIM: 605767
• UniProt ID: Q9NWQ8