Recombinant Human PAG1 Protein, His tagged

Cat.No. : PAG1-001H
Product Overview : Recombinant Human PAG1 Protein (38-432 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 38-432 aa
Description : The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation.
Molecular Mass : 44 kDa
AASequence : MSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRLHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : >90% estimated by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.88 mg/mL by BCA
Gene Name PAG1 phosphoprotein membrane anchor with glycosphingolipid microdomains 1 [ Homo sapiens (human) ]
Official Symbol PAG1
Synonyms PAG1; phosphoprotein associated with glycosphingolipid microdomains 1; phosphoprotein associated with glycosphingolipid-enriched microdomains 1; CBP; Csk binding protein; PAG; transmembrane adaptor protein PAG; Csk-binding protein; transmembrane phosphoprotein Cbp; transmembrane adapter protein PAG; FLJ37858; MGC138364
Gene ID 55824
mRNA Refseq NM_018440
Protein Refseq NP_060910
MIM 605767
UniProt ID Q9NWQ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAG1 Products

Required fields are marked with *

My Review for All PAG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon