Recombinant Human PAG1 Protein, His tagged
Cat.No. : | PAG1-001H |
Product Overview : | Recombinant Human PAG1 Protein (38-432 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 38-432 aa |
Description : | The protein encoded by this gene is a type III transmembrane adaptor protein that binds to the tyrosine kinase csk protein. It is thought to be involved in the regulation of T cell activation. |
Molecular Mass : | 44 kDa |
AASequence : | MSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRLHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | >90% estimated by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.88 mg/mL by BCA |
Gene Name | PAG1 phosphoprotein membrane anchor with glycosphingolipid microdomains 1 [ Homo sapiens (human) ] |
Official Symbol | PAG1 |
Synonyms | PAG1; phosphoprotein associated with glycosphingolipid microdomains 1; phosphoprotein associated with glycosphingolipid-enriched microdomains 1; CBP; Csk binding protein; PAG; transmembrane adaptor protein PAG; Csk-binding protein; transmembrane phosphoprotein Cbp; transmembrane adapter protein PAG; FLJ37858; MGC138364 |
Gene ID | 55824 |
mRNA Refseq | NM_018440 |
Protein Refseq | NP_060910 |
MIM | 605767 |
UniProt ID | Q9NWQ8 |
◆ Recombinant Proteins | ||
PAG1-30060TH | Recombinant Human PAG1, His-tagged | +Inquiry |
Pag1-522R | Recombinant Rat Pag1 Protein, His-tagged | +Inquiry |
Pag1-521M | Recombinant Mouse Pag1 Protein, His-tagged | +Inquiry |
PAG1-0031B | Recombinant Bovine PAG1 Protein (Arg54-Val380), N-His-tagged | +Inquiry |
◆ Native Proteins | ||
PAG1-001H | Recombinant Human PAG1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAG1-3465HCL | Recombinant Human PAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAG1 Products
Required fields are marked with *
My Review for All PAG1 Products
Required fields are marked with *
0
Inquiry Basket