Recombinant Human PAPSS2 protein, His-tagged

Cat.No. : PAPSS2-1524H
Product Overview : Recombinant Human PAPSS2 protein(1-333 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-333 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEF
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol PAPSS2
Synonyms PAPSS2; 3-phosphoadenosine 5-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthase 2; ATPSK2; SK 2; PAPSS 2; PAPS synthase 2; PAPS synthetase 2; ATP sulfurylase/APS kinase 2; ATP sulfurylase/adenosine 5-phosphosulfate kinase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthethase 2; SK2;
Gene ID 9060
mRNA Refseq NM_001015880
Protein Refseq NP_001015880
MIM 603005
UniProt ID O95340

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAPSS2 Products

Required fields are marked with *

My Review for All PAPSS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon