Recombinant Human PARG, GST-tagged
Cat.No. : | PARG-1528H |
Product Overview : | Recombinant Human PARG protein, fused to GST-tag, was expressed in E.coli and purified by GSH-sepharose. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 617-976aa |
Storage : | The protein is stored in PBS buffer at -20℃. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 1% Triton X-100,15%glycerol. |
Form : | Supplied as a 0.2 μm filtered solution in PBS (pH8.0). |
Description : | Poly(ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly(ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. Several transcript variants encoding different isoforms have been found for this gene |
Molecular Mass : | ~68.2 kDa |
Purity : | >90% |
Concentration : | 0.4 mg/ml |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGSQKMNHSITMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDINFNRLFEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQSLEDFPEWERCEKPLTRLHVTYEGTIEENGQGMLQVDFANRFVGGGVTSAGLVQEEIRFLINPELIISRLFTEVLDHNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGTAAAS |
Gene Name | PARG poly (ADP-ribose) glycohydrolase [ Homo sapiens ] |
Official Symbol | PARG |
Synonyms | PARG; poly (ADP-ribose) glycohydrolase; poly(ADP-ribose) glycohydrolase; poly(ADP-ribose) glycohydrolase 60 kDa isoform; PARG99; FLJ54459; FLJ60257; FLJ60456; |
Gene ID | 8505 |
mRNA Refseq | NM_003631 |
Protein Refseq | NP_003622 |
MIM | 603501 |
UniProt ID | Q86W56 |
Chromosome Location | 10q11.23 |
Function | chromatin binding; hydrolase activity; poly(ADP-ribose) glycohydrolase activity; |
◆ Recombinant Proteins | ||
PARG-3934R | Recombinant Rat PARG Protein, His (Fc)-Avi-tagged | +Inquiry |
PARG-4272R | Recombinant Rat PARG Protein | +Inquiry |
PARG-87H | Recombinant Human PARG protein, GST-tagged | +Inquiry |
PARG-2548H | Recombinant Human PARG Protein, His-tagged | +Inquiry |
PARG-1171H | Recombinant Human PARG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARG-3434HCL | Recombinant Human PARG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PARG Products
Required fields are marked with *
My Review for All PARG Products
Required fields are marked with *
0
Inquiry Basket