Recombinant Human PARN protein, His-tagged
| Cat.No. : | PARN-3049H |
| Product Overview : | Recombinant Human PARN protein is produced by Yeast expression system. This protein is fused with a His tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-639 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 75.5 kDa |
| AA Sequence : | MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Gene Name | PARN poly(A)-specific ribonuclease [ Homo sapiens ] |
| Official Symbol | PARN |
| Synonyms | PARN; poly(A)-specific ribonuclease; poly(A) specific ribonuclease (deadenylation nuclease); poly(A)-specific ribonuclease PARN; DAN; |
| Gene ID | 5073 |
| mRNA Refseq | NM_001134477 |
| Protein Refseq | NP_001127949 |
| MIM | 604212 |
| UniProt ID | O95453 |
| ◆ Recombinant Proteins | ||
| PARN-30788TH | Recombinant Human PARN | +Inquiry |
| Parn-4677M | Recombinant Mouse Parn Protein, Myc/DDK-tagged | +Inquiry |
| PARN-4799H | Recombinant Human PARN Protein (Lys178-Asp245), N-GST tagged | +Inquiry |
| PARN-1608H | Recombinant Human PARN Protein, His (Fc)-Avi-tagged | +Inquiry |
| PARN-6501M | Recombinant Mouse PARN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PARN-3430HCL | Recombinant Human PARN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARN Products
Required fields are marked with *
My Review for All PARN Products
Required fields are marked with *
