Recombinant Human PARN protein, His-tagged
Cat.No. : | PARN-3048H |
Product Overview : | Recombinant Human PARN protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-639 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 77.5 kDa |
AA Sequence : | MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPFFNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRLNPQCIPYTLQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAEPLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Gene Name | PARN poly(A)-specific ribonuclease [ Homo sapiens ] |
Official Symbol | PARN |
Synonyms | PARN; poly(A)-specific ribonuclease; poly(A) specific ribonuclease (deadenylation nuclease); poly(A)-specific ribonuclease PARN; DAN; |
Gene ID | 5073 |
mRNA Refseq | NM_001134477 |
Protein Refseq | NP_001127949 |
MIM | 604212 |
UniProt ID | O95453 |
◆ Recombinant Proteins | ||
PARN-473H | Recombinant Human PARN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PARN-4799H | Recombinant Human PARN Protein (Lys178-Asp245), N-GST tagged | +Inquiry |
PARN-3049H | Recombinant Human PARN protein, His-tagged | +Inquiry |
PARN-372H | Recombinant Human Lefty1 Protein, His/GST-tagged | +Inquiry |
PARN-11311Z | Recombinant Zebrafish PARN | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARN-3430HCL | Recombinant Human PARN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PARN Products
Required fields are marked with *
My Review for All PARN Products
Required fields are marked with *