Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PAWR

Cat.No. : PAWR-28664TH
Product Overview : Recombinant fragment of Human PAR4 with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : The tumor suppressor WT1 represses and activates transcription. The protein encoded by this gene is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEK KIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLL NRDLDDIEDENEQLKQENKTLLKVVGQLTR
Gene Name : PAWR PRKC, apoptosis, WT1, regulator [ Homo sapiens ]
Official Symbol : PAWR
Synonyms : PAWR; PRKC, apoptosis, WT1, regulator; PRKC apoptosis WT1 regulator protein; par 4; PAR4;
Gene ID : 5074
mRNA Refseq : NM_002583
Protein Refseq : NP_002574
MIM : 601936
Uniprot ID : Q96IZ0
Chromosome Location : 12q21.2
Pathway : Ceramide signaling pathway, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem;
Function : actin binding; enzyme binding; leucine zipper domain binding; protein binding; transcription corepressor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends