Recombinant Human PAWR
Cat.No. : | PAWR-28664TH |
Product Overview : | Recombinant fragment of Human PAR4 with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The tumor suppressor WT1 represses and activates transcription. The protein encoded by this gene is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEK KIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLL NRDLDDIEDENEQLKQENKTLLKVVGQLTR |
Gene Name | PAWR PRKC, apoptosis, WT1, regulator [ Homo sapiens ] |
Official Symbol | PAWR |
Synonyms | PAWR; PRKC, apoptosis, WT1, regulator; PRKC apoptosis WT1 regulator protein; par 4; PAR4; |
Gene ID | 5074 |
mRNA Refseq | NM_002583 |
Protein Refseq | NP_002574 |
MIM | 601936 |
Uniprot ID | Q96IZ0 |
Chromosome Location | 12q21.2 |
Pathway | Ceramide signaling pathway, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem; |
Function | actin binding; enzyme binding; leucine zipper domain binding; protein binding; transcription corepressor activity; |
◆ Recombinant Proteins | ||
PAWR-1532Z | Recombinant Zebrafish PAWR | +Inquiry |
PAWR-7950HFL | Recombinant Full Length Human PAWR, Flag-tagged | +Inquiry |
PAWR-6514M | Recombinant Mouse PAWR Protein, His (Fc)-Avi-tagged | +Inquiry |
PAWR-538H | Recombinant Human PAWR protein, His & GST-tagged | +Inquiry |
Pawr-528M | Recombinant Mouse Pawr Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAWR-3420HCL | Recombinant Human PAWR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAWR Products
Required fields are marked with *
My Review for All PAWR Products
Required fields are marked with *