Recombinant Human PAX6 protein, GST-tagged

Cat.No. : PAX6-1803H
Product Overview : Recombinant Human PAX6 protein(126-229 aa), fused to GST tag, was expressed in E. coli.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 126-229 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : VLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEF
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PAX6 paired box 6 [ Homo sapiens ]
Official Symbol PAX6
Synonyms PAX6; paired box 6; AN2, paired box gene 6 (aniridia, keratitis); paired box protein Pax-6; AN; aniridia; keratitis; D11S812E; WAGR; oculorhombin; aniridia type II protein; paired box homeotic gene-6; AN2; MGDA; MGC17209;
Gene ID 5080
mRNA Refseq NM_000280
Protein Refseq NP_000271
MIM 607108
UniProt ID P26367

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PAX6 Products

Required fields are marked with *

My Review for All PAX6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon