Recombinant Human PAX6 protein, GST-tagged
Cat.No. : | PAX6-1803H |
Product Overview : | Recombinant Human PAX6 protein(126-229 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 126-229 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | VLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PAX6 paired box 6 [ Homo sapiens ] |
Official Symbol | PAX6 |
Synonyms | PAX6; paired box 6; AN2, paired box gene 6 (aniridia, keratitis); paired box protein Pax-6; AN; aniridia; keratitis; D11S812E; WAGR; oculorhombin; aniridia type II protein; paired box homeotic gene-6; AN2; MGDA; MGC17209; |
Gene ID | 5080 |
mRNA Refseq | NM_000280 |
Protein Refseq | NP_000271 |
MIM | 607108 |
UniProt ID | P26367 |
◆ Recombinant Proteins | ||
PAX6-148H | Recombinant Human PAX6 Protein, His-tagged | +Inquiry |
PAX6-1884H | Recombinant Human PAX6 protein, His-tagged | +Inquiry |
PAX6-29055TH | Recombinant Human PAX6 | +Inquiry |
PAX6-6623C | Recombinant Chicken PAX6 | +Inquiry |
PAX6-3946R | Recombinant Rat PAX6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX6-3415HCL | Recombinant Human PAX6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX6 Products
Required fields are marked with *
My Review for All PAX6 Products
Required fields are marked with *