Recombinant Human PAX8 protein, His&Myc-tagged
Cat.No. : | PAX8-3320H |
Product Overview : | Recombinant Human PAX8 protein(Q06710)(1-450aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-450aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PAX8 paired box 8 [ Homo sapiens ] |
Official Symbol | PAX8 |
Synonyms | PAX8; paired box 8; paired box gene 8; paired box protein Pax-8; paired domain gene 8; |
Gene ID | 7849 |
mRNA Refseq | NM_003466 |
Protein Refseq | NP_003457 |
MIM | 167415 |
UniProt ID | Q06710 |
◆ Recombinant Proteins | ||
Pax8-4687M | Recombinant Mouse Pax8 Protein, Myc/DDK-tagged | +Inquiry |
PAX8-6519M | Recombinant Mouse PAX8 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAX8-6665H | Recombinant Human PAX8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PAX8-29058TH | Recombinant Human PAX8 | +Inquiry |
PAX8-4285R | Recombinant Rat PAX8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX8-3412HCL | Recombinant Human PAX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAX8 Products
Required fields are marked with *
My Review for All PAX8 Products
Required fields are marked with *