Recombinant Human PCBD1 Protein (2-104 aa), His-tagged
| Cat.No. : | PCBD1-1479H |
| Product Overview : | Recombinant Human PCBD1 Protein (2-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-104 aa |
| Description : | Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 13.9 kDa |
| AA Sequence : | AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | PCBD1 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [ Homo sapiens ] |
| Official Symbol | PCBD1 |
| Synonyms | PCBD1; PCD; PHS; DCOH; PCBD; |
| Gene ID | 5092 |
| mRNA Refseq | NM_000281 |
| Protein Refseq | NP_000272 |
| MIM | 126090 |
| UniProt ID | P61457 |
| ◆ Recombinant Proteins | ||
| PCBD1-1479H | Recombinant Human PCBD1 Protein (2-104 aa), His-tagged | +Inquiry |
| PCBD1-1804H | Recombinant Human PCBD1 protein, GST-tagged | +Inquiry |
| PCBD1-11070Z | Recombinant Zebrafish PCBD1 | +Inquiry |
| PCBD1-30550TH | Recombinant Human PCBD1, His-tagged | +Inquiry |
| PCBD1-6467C | Recombinant Chicken PCBD1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCBD1-385HKCL | Human PCBD1 Knockdown Cell Lysate | +Inquiry |
| PCBD1-3405HCL | Recombinant Human PCBD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCBD1 Products
Required fields are marked with *
My Review for All PCBD1 Products
Required fields are marked with *
