Recombinant Human PCBD1 Protein (2-104 aa), His-tagged
Cat.No. : | PCBD1-1479H |
Product Overview : | Recombinant Human PCBD1 Protein (2-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-104 aa |
Description : | Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.9 kDa |
AA Sequence : | AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PCBD1 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [ Homo sapiens ] |
Official Symbol | PCBD1 |
Synonyms | PCBD1; PCD; PHS; DCOH; PCBD; |
Gene ID | 5092 |
mRNA Refseq | NM_000281 |
Protein Refseq | NP_000272 |
MIM | 126090 |
UniProt ID | P61457 |
◆ Recombinant Proteins | ||
PCBD1-11070Z | Recombinant Zebrafish PCBD1 | +Inquiry |
PCBD1-1804H | Recombinant Human PCBD1 protein, GST-tagged | +Inquiry |
PCBD1-4291R | Recombinant Rat PCBD1 Protein | +Inquiry |
PCBD1-12411M | Recombinant Mouse PCBD1 Protein | +Inquiry |
PCBD1-30550TH | Recombinant Human PCBD1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBD1-3405HCL | Recombinant Human PCBD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCBD1 Products
Required fields are marked with *
My Review for All PCBD1 Products
Required fields are marked with *
0
Inquiry Basket