Recombinant Human PCBD1 Protein (2-104 aa), His-tagged

Cat.No. : PCBD1-1479H
Product Overview : Recombinant Human PCBD1 Protein (2-104 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 2-104 aa
Description : Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.9 kDa
AA Sequence : AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name PCBD1 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [ Homo sapiens ]
Official Symbol PCBD1
Synonyms PCBD1; PCD; PHS; DCOH; PCBD;
Gene ID 5092
mRNA Refseq NM_000281
Protein Refseq NP_000272
MIM 126090
UniProt ID P61457

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCBD1 Products

Required fields are marked with *

My Review for All PCBD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon