Recombinant Human PCBD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PCBD1-1908H |
Product Overview : | PCBD1 MS Standard C13 and N15-labeled recombinant protein (NP_000272) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the pterin-4-alpha-carbinolamine dehydratase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein functions as both a dehydratase involved in tetrahydrobiopterin biosynthesis, and as a cofactor for HNF1A-dependent transcription. A deficiency of this enzyme leads to hyperphenylalaninemia. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 12 kDa |
AA Sequence : | MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PCBD1 pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [ Homo sapiens (human) ] |
Official Symbol | PCBD1 |
Synonyms | PCBD1; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; 6 pyruvoyl tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1), DCOH, PCBD, pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); pterin-4-alpha-carbinolamine dehydratase; dimerizing cofactor for HNF1; PCD; pterin 4 alpha carbinolamine dehydratase; Pterin 4a carbinolamine dehydratase (dimerization cofactor of hepatic nuclear factor 1 alpha); dimerization cofactor of HNF1; 4-alpha-hydroxy-tetrahydropterin dehydratase; phenylalanine hydroxylase-stimulating protein; 6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1); PHS; DCOH; PCBD; |
Gene ID | 5092 |
mRNA Refseq | NM_000281 |
Protein Refseq | NP_000272 |
MIM | 126090 |
UniProt ID | P61457 |
◆ Recombinant Proteins | ||
PCBD1-4805H | Recombinant Human PCBD1 Protein (Ala2-Thr104), N-His tagged | +Inquiry |
PCBD1-3321H | Recombinant Human PCBD1 protein, His-GST-tagged | +Inquiry |
PCBD1-11070Z | Recombinant Zebrafish PCBD1 | +Inquiry |
PCBD1-1804H | Recombinant Human PCBD1 protein, GST-tagged | +Inquiry |
PCBD1-1479H | Recombinant Human PCBD1 Protein (2-104 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBD1-3405HCL | Recombinant Human PCBD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCBD1 Products
Required fields are marked with *
My Review for All PCBD1 Products
Required fields are marked with *
0
Inquiry Basket