Recombinant Human PCDHA10 protein, GST-tagged

• Cat.No.: PCDHA10-301195H
• Product Overview: Recombinant Human PCDHA10 protein(276-324 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 276-324 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MMYSFSSLVPPTIRRKFWINERTGEIKVNDAIDFEDSNTYEIHVDVTDK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: PCDHA10
• Synonyms: PCDHA10; protocadherin alpha 10; CNRS8; protocadherin alpha-10; CNR8; CNRN8; CRNR8; KIAA0345 like 4; ortholog to mouse CNR8; PCDH ALPHA10; PCDH-alpha-10; KIAA0345-like 4; PCDH-ALPHA10
• Gene ID: 56139
• mRNA Refseq: NM_018901
• Protein Refseq: NP_061724
• MIM: 606316
• UniProt ID: Q9Y5I2